(data stored in ACNUC7421 zone)

EMBL: CP000947.PE266

CP000947.PE266       Location/Qualifiers
FT   CDS_pept        289047..292526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0270"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /note="KEGG: nme:NMB1768 hemagglutinin/hemolysin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31899"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW75"
FT                   /protein_id="ACA31899.1"
FT                   /translation="MDNYYRLEQHQEVGSQLNGKGNITLAGEQGVVIRQGEIHSENGDV
FT                   HIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTDITKHDHHYDLAQGSTLDGKNVVL
FT                   QSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVFEQDVEKTTKSGLMGSGGFGFSIG
FT                   EKKTTTETNQTKYYATGSQAGSLKGNTTLLAQEHYHQQGSTLSSLEGDVTIGAKKVDIL
FT                   AADDRYESHYKQTMEQKGFTIAVNIPVVQAVQNTLAVAKQAEQVGESKHSRINAMAAAN
FT                   TAWSAYRAGQGLMQASQSLSQMASGNMAQGANVSVSITYGEQKNVQTTDIQGNRAANSA
FT                   INAGGKVTVIATGAGKESDIHVVGSDVSGKQGTFLQAEDDINLRAAKQTHQERSQNKSA
FT                   GFNAGVAVSYGSNGLAFGFTAGGNYGKGYGNGDETTWRNSHIGDKHSQTHIMSGGDTAI
FT                   KGAQVRGKGVQVQAQNLNIESLQDTMTYKGKQMNVSGQVTVGYGFSASANFNQSKINAD
FT                   YASVQEQSGIYAGNEGYQINIAQHTDLKGGLITSTEQAEKQGKNQFSTGTLSYSDIQNH
FT                   ADYKGSRIGLSGSMAINFDTPLGKYGQAQSQKQAVNDKGEKLYIDSQGKQTTASRDSAG
FT                   NANQAKLAKGLDSLTGTTSFGFGSDRDHQRSETKSGINTTNIAIRDEQGQLKKTTKTVE
FT                   QIAAEVKTNMTTDNAESRSGKLENRFDKDELQKELDLQRTVSQDFSKNVQAANAKINQH
FT                   LDQLKTQREKGEISQSDYDTRVRSWQRGQVLLNSVASGLIAPTQSTIGIVAATASPALS
FT                   YEIGQHFKGLAKANQLTGKTEREELTVEQKAAHILAHAVLGAAAAAAGDNHALAGAISA
FT                   GGAEAATPVIGKWLYGKDKGSDLTAKEKETVTSIIGLLGAAIGTTVGNSSTNAVQGSLN
FT                   AQSAVENNSLHVDKNGVVIRNISNDDYNIYQYDYACSPVAGNNCPNLKDFDELYNSPKK
FT                   VVGQVMWQDSFTSPESGKSFGIIHFGENIEPYIYQLNDKAWGQWDITVAIKSLPGGEYD
FT                   IKSNYPSAGSYHGFLFQGKYISLRDGGNILAGMNAAVNRKTFDEFQQASGALQQGGKIG
FT                   VLLNVFTGKTYGSAPMYGELPYQYNKSKYGYDLGLERIWIKDDMKNMIPNNK"
     atggataatt actaccgctt agaacagcat caagaagtcg gttctcaatt aaatggaaaa        60
     ggtaatatca cccttgccgg tgaacagggc gttgtgattc gccaagggga aattcatagc       120
     gagaacggtg atgttcatat tgcctcaaac ggtaatattc gcattgaaga agggcgtaac       180
     aaagagcggc tttcttctgc ctctaaagtg aagcatagtg gttttcttca atccacgaca       240
     gatatcacta aacatgacca ccattatgat ttagctcaag gctcaaccct tgatggtaag       300
     aatgtggtgt tgcaaagcaa tgctaacctg acggttcaag gctcaaatat tgttgctgaa       360
     aatcagctca atgctcgagc gaaaaacatc gcaattaagg aagcagaaaa ccgtgttttc       420
     gaacaagatg ttgagaaaac cacgaaatca ggcttaatgg gttcaggggg atttggcttt       480
     agcattggcg aaaagaaaac caccacagaa accaatcaaa ccaaatatta cgccacaggt       540
     agccaagcag gtagcctaaa agggaacact accctacttg cccaagagca ttatcaccaa       600
     caaggcagta ccctctcttc ccttgagggc gatgtgacta tcggtgcgaa aaaagtcgat       660
     attttggctg cagatgacag atacgaaagc cattataaac agacgatgga acaaaaaggc       720
     tttacgattg cggtgaatat tccggtggtg caggcggtgc aaaataccct tgcggtagcg       780
     aaacaagccg aacaggtggg cgaaagcaaa cacagtcgaa ttaatgccat ggcagcggcg       840
     aataccgcat ggagtgcgta tcgagcggga caagggttaa tgcaagcgag tcaaagtctt       900
     agccaaatgg cgagcggtaa tatggcacaa ggggcgaatg tcagcgtatc tatcacttat       960
     ggcgaacaaa agaatgtgca gaccacggat atccaaggca acagggcagc aaacagtgcg      1020
     ataaatgcgg gtggaaaagt caccgttatc gccaccggag caggcaagga atcggatatt      1080
     cacgttgtgg gttcggatgt gtccggtaaa cagggtactt ttttgcaagc agaagatgac      1140
     atcaatttac gggcagccaa acaaacccac caagagcgga gccaaaataa atccgccggt      1200
     tttaatgcgg gtgtggcggt gagttacggc tcaaatggtt tagcctttgg atttaccgca      1260
     gggggaaatt atggcaaagg ctatggcaac ggcgatgaaa ccacttggcg aaatagccat      1320
     ataggcgata aacacagcca aacccacatc atgagcggtg gagatactgc cattaaggga      1380
     gcccaagtgc gaggcaaagg cgtacaagtt caagcccaaa acctcaacat tgaaagcctg      1440
     caagatacca tgacgtataa aggcaaacaa atgaatgtga gcggacaagt gacggtgggc      1500
     tatggctttt ccgcctccgc caatttcaat caatcgaaaa tcaacgccga ttatgccagc      1560
     gtacaagaac aatcggggat atatgcaggg aatgaggggt atcaaattaa cattgcccaa      1620
     cacactgacc tcaaaggtgg cttaatcacc tctactgaac aagccgaaaa acagggtaaa      1680
     aaccaattca gcacaggcac actctcctac tcggatattc aaaatcacgc cgattataaa      1740
     ggcagccgta tcgggttaag tggttcaatg gcaataaact ttgacacgcc gttaggcaaa      1800
     tacggacaag cccaaagcca aaaacaagca gtgaatgaca aaggcgaaaa actttacata      1860
     gatagccaag gcaagcaaac caccgcaagc cgagacagtg caggtaatgc gaatcaagcc      1920
     aaattggcga aaggcttaga ttctttaacg gggacgacct ctttcggatt cggatcagat      1980
     agagaccatc aaagaagtga aaccaaatca ggtattaata ccacaaatat cgcaattaga      2040
     gacgaacaag gacagcttaa aaagacgact aaaaccgttg aacaaatcgc agcggaagtt      2100
     aaaacgaaca tgaccaccga caatgccgaa agccgttcgg gtaagctgga aaaccgtttt      2160
     gacaaagatg agttacaaaa agagttggat ttacaaagaa cggttagcca agactttagt      2220
     aaaaatgttc aggctgctaa tgccaaaatc aatcaacacc ttgatcaact caaaacacag      2280
     cgagaaaaag gcgaaataag tcaaagcgac tatgacactc gggtgagaag ttggcaacga      2340
     gggcaagtgc tactcaacag tgttgcctca ggtttaattg caccgacaca aagcacaata      2400
     ggcatagtag cagccaccgc atcgccggca ttatcgtatg aaattgggca acactttaaa      2460
     ggattagcca aagcaaacca actcacagga aaaactgaac gagaagagtt aaccgtggaa      2520
     caaaaagctg cacatatcct tgctcatgca gtattaggag cggcggccgc cgcagcagga      2580
     gataatcatg ccctagcagg agcaataagt gcaggtgggg cggaagctgc tacacctgtg      2640
     attggtaaat ggttatatgg aaaagacaaa ggaagtgatt taacagctaa agagaaagaa      2700
     accgtgacct cgataatcgg tttgctgggt gctgcaatag gcacaacagt cggcaacagc      2760
     tcaacaaacg cagtacaagg cagcctgaat gcacaaagtg cagtggagaa taatagcctt      2820
     catgttgata aaaatggtgt agttattcgt aatatttcta atgatgacta caatatttat      2880
     caatatgatt atgcttgttc tcctgttgct ggaaataatt gtcctaattt gaaagatttt      2940
     gatgagttgt ataattcccc caaaaaagtt gtaggtcaag taatgtggca ggactcattt      3000
     accagtccag aatcaggaaa atcttttggt attatacatt ttggagaaaa tatagaacca      3060
     tatatctatc aacttaatga taaagcatgg gggcaatggg atataactgt tgctataaaa      3120
     agtcttccag gtggagaata cgatataaaa agcaattatc ctagtgctgg ttcatatcat      3180
     ggatttttat ttcagggtaa atatatctca ttgagagatg gtggaaatat cttagcaggt      3240
     atgaatgctg ctgttaatag aaaaactttt gatgagtttc aacaagccag tggagcacta      3300
     caacaaggtg gtaagatagg tgttttatta aatgtgttta ccggtaagac ttacggatct      3360
     gctcctatgt atggtgaatt accatatcaa tacaataaaa gtaaatatgg ttacgattta      3420
     ggactagaaa ggatatggat aaaagacgat atgaaaaata tgattcctaa taataaataa      3480
//

If you have problems or comments...

PBIL Back to PBIL home page