(data stored in ACNUC7421 zone)

EMBL: CP000947.PE267

CP000947.PE267       Location/Qualifiers
FT   CDS_pept        292546..293073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31900"
FT                   /db_xref="GOA:B0UW76"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW76"
FT                   /protein_id="ACA31900.1"
FT                   /translation="MEFVNNFNILSLLLLIFIPIFLTIYVIYHAIHYHKTYILKMSFVL
FT                   LGLIFFSMYYIHCRYIDPQKIAHYCIDGKCISIVHLCKGCGINSPTYAKIYDGKILFRF
FT                   QTKTRNHAEFLMEDDILISKIILGNKFIIYGSLPLMYGNVDTIKVKEAAGYINEERIDY
FT                   IASRKLKFRYLY"
     atggaattcg ttaataattt taacattttg tcacttttat tactaatatt tattccgata        60
     tttcttacaa tatacgttat ataccatgcc attcattatc ataaaacata tatattaaaa       120
     atgagctttg tattattggg attaatattt ttcagtatgt attacataca ttgccgttat       180
     attgatccac aaaaaatagc tcattattgc atagatggaa aatgtatttc tattgttcat       240
     ctatgcaaag gttgcggtat aaactctcct acatatgcga aaatctatga cggaaagata       300
     ttatttagat ttcaaacaaa aactagaaat cacgccgaat tccttatgga agatgatata       360
     ttaattagta aaataatatt ggggaataaa tttatcattt atgggtcatt acctttaatg       420
     tacggtaatg tagatactat taaagtaaaa gaagcagctg gttatataaa tgaagaaaga       480
     attgactata ttgcttcaag aaaattaaaa tttagatatt tatattaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page