(data stored in ACNUC7421 zone)

EMBL: CP000947.PE268

CP000947.PE268       Location/Qualifiers
FT   CDS_pept        293222..294907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31901"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW77"
FT                   /protein_id="ACA31901.1"
FT                   /translation="MRQDTMTYKGKQMNVKGQVTVGYGFSASADFNQSKINADYASVQE
FT                   QSGIYAGDEGYQINIAQHTDLKGGLITSTAQAEKQGKNQFSTGTLSYSDIQNYSHHSAR
FT                   GFGLSGGVTVSGGEAPKEIGGMNLQHIGQNAQDGSSKVEYSGIAGVSSQGNWGITKGIT
FT                   TALLGQVKYKGSESGITTGSINTAHITIRHRDAQQKLTGKTVEESLQNLPKINLHQGVE
FT                   KADVETIRSDLARDLNTATEFVNNLNNQGDEIHYKMEKNEDSLFSIQKTRSDCDHISCL
FT                   DFDKDNSQELKRIIYSEELLTEEQAKLFSKVATAGMLNLTREAKVSSAVLYDKDLSSIE
FT                   DTALILNRGSAGILNEIIFTGFERFRAWVNMPAIFGASNATRAHAQIAKKLDEYNAYAE
FT                   SRGTKTYTFKNSAHSLGVSGNKNMLNWSEHIGQKYEHTDVEYLHLGGSYPSSEIDQQSR
FT                   RLFKSVKTQYHGVKGDFVYEGTPVLRNLGLGMIGNNPNATPNKANVSFLDTHTKANQNI
FT                   NNLKFVYKSEENGTKTKEWLTIEDMLKKTYTEGIRKFNEINGGR"
     atgcgacaag atactatgac gtataaaggc aaacaaatga atgtgaaagg acaggtaacg        60
     gtgggctatg gcttttccgc ctccgctgat ttcaatcaat cgaaaatcaa cgccgattat       120
     gccagcgtac aagaacaatc ggggatttat gcaggagatg aggggtatca aattaacatt       180
     gcccaacaca ctgacctcaa aggcggctta atcacctcca ccgcccaagc cgaaaaacaa       240
     ggtaaaaacc aattcagcac aggcacactt tcttattcgg atattcaaaa ctatagccac       300
     cattcagcga gaggatttgg cttaagcggc ggtgtaacgg taagtggtgg tgaggctcca       360
     aaagaaattg gcggaatgaa cctccaacac attggacaaa atgctcaaga cggttcatca       420
     aaagtggaat acagtggtat tgcaggggtg agtagccaag gtaattgggg aataacaaaa       480
     ggcattacaa ccgcactttt aggtcaagtg aaatataaag gtagcgaaag cggtatcaca       540
     accggctcaa tcaataccgc tcatatcacc attcgccatc gtgatgctca acaaaaactg       600
     accggaaaaa cagtggagga aagtttacaa aaccttccta aaatcaatct tcatcaaggt       660
     gttgaaaaag ctgatgttga gactattcgc tcagatttag cacgtgattt aaatacagca       720
     acagagtttg tgaataactt aaataatcaa ggtgatgaaa ttcattataa gatggaaaaa       780
     aatgaagact ctcttttttc tatccaaaaa acaagatcag actgtgatca tatttcttgc       840
     ttggattttg ataaagacaa ctctcaggag ctaaaacgta ttatttatag tgaagaattg       900
     ctgacagagg aacaagcaaa attattcagt aaagtcgcaa cggcaggcat gttgaatttg       960
     actagagaag cgaaagtttc aagtgccgtt ttatatgata aggacttgtc ctcaattgaa      1020
     gatactgcat tgattttaaa tagaggaagt gcgggtattt taaatgaaat tatatttacc      1080
     ggttttgaac gtttcagagc gtgggtaaat atgccggcga tctttggagc atcaaatgcg      1140
     acgagagctc atgctcagat tgcgaaaaaa ctggatgaat ataatgctta cgcagaatct      1200
     cgtggaacaa aaacatatac atttaaaaat tcagcacata gtttaggcgt ttcgggcaat      1260
     aaaaatatgt tgaattggtc ggagcatatt ggtcagaaat atgaacatac tgatgtagaa      1320
     tatttacatt taggcggttc atatccgtca agtgaaatag atcaacaatc gaggagatta      1380
     tttaagagcg tcaaaacaca gtatcatggc gtaaagggtg attttgtcta tgagggaaca      1440
     ccagttttaa gaaatttagg gttgggaatg attgggaata atcctaatgc aacacctaat      1500
     aaagcaaatg tttctttttt agatacacat actaaagcca atcagaatat taataattta      1560
     aagtttgttt ataaatcaga agaaaatgga acgaaaacta aagaatggtt aacaatagag      1620
     gatatgttaa aaaagacata tactgaagga attagaaaat ttaatgaaat taatgggggt      1680
     agataa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page