(data stored in ACNUC7421 zone)

EMBL: CP000947.PE269

CP000947.PE269       Location/Qualifiers
FT   CDS_pept        294885..295271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW78"
FT                   /protein_id="ACA31902.1"
FT                   /translation="MKLMGVDNMKKFVFLVFFLLSGCSAIISLYPGYDKDVMHGERFWV
FT                   KKGTNEQVSEKTYVACFHKGLQFDLNQKGFTSYSPDWDEYNVALYQSKCLHDLGYAFKE
FT                   DIFSKYCYHYQNELNCKAYRKFKY"
     atgaaattaa tgggggtaga taatatgaaa aaatttgttt ttttagtgtt ttttttgttg        60
     tcaggttgtt ctgctattat ctctttatat cctgggtatg ataaggatgt tatgcatggt       120
     gaaagattct gggtaaaaaa aggaactaat gaacaagtca gtgaaaaaac gtatgtagct       180
     tgttttcata aaggcttaca atttgattta aaccaaaaag gttttacatc atattcacct       240
     gattgggatg agtataatgt tgctttatat caaagtaaat gtttgcatga tttaggatat       300
     gcttttaaag aggatatatt ttcaaaatat tgttaccatt accaaaatga acttaactgt       360
     aaggcatatc ggaaatttaa atattag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page