(data stored in ACNUC7421 zone)

EMBL: CP000947.PE27

CP000947.PE27        Location/Qualifiers
FT   CDS_pept        complement(22380..22694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31898"
FT                   /db_xref="GOA:B0UUY5"
FT                   /db_xref="InterPro:IPR035333"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY5"
FT                   /protein_id="ACA31898.1"
FT                   /translation="MKKQNMPTGFSRFSWALVGFCLPVLLWPLALLISPNFIKNPNLDD
FT                   FQMRWMSIFFWAYPFILGIIARYSFKLNQRNSQLAKYVLLLSAVIFYSVLIYVCAAGLN
FT                   "
     atgaaaaaac aaaacatgcc aaccggattt agtagatttt cttgggcact cgttgggttt        60
     tgcctacctg ttttgctttg gccattagct ctcttaatct cacctaattt cattaaaaat       120
     ccaaatttgg atgattttca aatgagatgg atgtcaattt tcttttgggc ttatcctttt       180
     attttaggca ttattgctcg ttattcattt aaattaaatc aacgtaacag tcagctggca       240
     aaatatgttt tgctactaag tgcggtgatt ttttatagtg ttttaattta tgtttgtgca       300
     gctggactga actaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page