(data stored in ACNUC7421 zone)

EMBL: CP000947.PE270

CP000947.PE270       Location/Qualifiers
FT   CDS_pept        295335..296903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0274"
FT                   /product="adhesin HecA 20-residue repeat X2"
FT                   /note="KEGG: mfa:Mfla_0483 adhesin HecA 20-residue repeat
FT                   X2"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW79"
FT                   /protein_id="ACA31903.1"
FT                   /translation="MQSYFLNISGQMTVGYGFSASANFNQSKINADYASVQEQSGIYAG
FT                   DEGYQINIAQHTDLKGGLITSTENAETENRNQFSTGTFTYSDIQNHADYKGSSIGLSGS
FT                   MAINFDTPLGKYGQVQSNKQAVNDKGEKLYIDSQGRQTTTSRDSAGNANQAKLAKGLDS
FT                   LTGTTSFGFGYDKESQSSVTKSGINTQNLIIRDEQGQVEKTGKTVEQVKAEVKTNITTD
FT                   NAESRSGKLENKFDKEKVLKELNIQVKVTQEFRKNAFSTIDAYVLPKQAELREKIKAAQ
FT                   TEEEKDELYKEIYKLQYQKRLLETTVGIIAGTPEIAITQGTLQLAATKMREETLKNSRL
FT                   FKGIKDKKTGQILRNDSYSSGYFDGVKLGGVRIDVDVICNSGMGACSKNNDGSITFNGT
FT                   NDYTLKDAIDPTQNNKAKKLYGETGGFQAVEGGWYFNGEPIFKYKLGSISDLSVESFAG
FT                   THDMSGSQIWGWYDKLGNTAPKTPMQDTSSKATTIIAIPISAPFAVADLMSADFFEVLM
FT                   KIGGQ"
     atgcaatcat atttcttgaa tatcagcgga cagatgacgg tgggctatgg cttttccgcc        60
     tccgccaatt tcaatcaatc gaaaatcaac gccgattatg ccagcgtaca agaacaatcg       120
     gggatttatg caggagatga ggggtatcaa attaacattg cccaacacac tgaccttaaa       180
     ggcggcttaa tcacctcgac agaaaacgca gagacggaaa accgcaacca attcagcaca       240
     ggcacattca cctattcgga tattcaaaat cacgctgatt ataaaggcag cagtatcggg       300
     ttaagtggtt caatggcaat aaactttgac acgccgttag gcaaatacgg acaagtgcaa       360
     agtaataaac aggcggtgaa tgacaaaggg gaaaaacttt acatagatag ccaaggcagg       420
     caaaccacca caagccgaga cagtgcaggt aatgcaaacc aagccaaatt ggcgaaaggt       480
     ttagattctt taacggggac gacctctttc ggattcggct atgacaaaga aagccaatct       540
     agcgtaacaa aaagtgggat taatacgcaa aacctcatca ttcgtgacga acaaggacag       600
     gttgaaaaaa cgggtaaaac cgttgagcaa gtgaaagcgg aagttaaaac gaacataacc       660
     accgacaatg ccgaaagccg ttcgggtaag ttggaaaata aatttgataa ggaaaaagtc       720
     ttaaaagaac ttaatattca ggtaaaagta acacaggagt tcaggaagaa tgcattttcg       780
     acgatagatg cttatgtact gccaaaacag gctgaattaa gggaaaaaat aaaagcagca       840
     caaactgaag aggaaaaaga tgaactgtat aaggaaattt ataaattgca atatcaaaaa       900
     cgcttgttag aaacgacagt aggtattatt gccggtacac ctgagattgc tattacacaa       960
     ggaacgctac aacttgcagc gaccaaaatg cgagaagaaa cgctaaaaaa ttcccgctta      1020
     tttaaaggaa ttaaggataa aaagacggga caaatattga gaaatgacag ttacagtagt      1080
     ggttattttg atggcgtgaa gttaggtggt gtacgaattg atgttgatgt gatttgtaat      1140
     agcggaatgg gggcttgttc taaaaataat gatggttcta taacttttaa tggaaccaat      1200
     gattacacac ttaaagatgc aatagatcct acacaaaata ataaagcaaa aaaattatat      1260
     ggtgaaacag gtggtttcca agcggtagag gggggatggt attttaatgg agaacctatt      1320
     tttaaatata aacttggcag tatttcagat ttatctgttg aatcttttgc gggtacacac      1380
     gatatgtcag gcagtcaaat ttggggttgg tatgacaaat tagggaatac agcccctaaa      1440
     acaccaatgc aagatacgtc atctaaagca acaactataa ttgctattcc tatatctgca      1500
     ccttttgccg tagcagatct catgtctgct gatttttttg aagttttaat gaaaatcgga      1560
     ggtcaataa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page