(data stored in ACNUC7421 zone)

EMBL: CP000947.PE271

CP000947.PE271       Location/Qualifiers
FT   CDS_pept        296905..297255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31904"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW80"
FT                   /protein_id="ACA31904.1"
FT                   /translation="MKKAVLIFILFLLAGCSYHDGCFYSPQLVSCVDKGEVFPSISRYQ
FT                   KPYSLGRTDSNQRWKDVISCGGKYLDYDQRSVPFEKQEEFYYCMLGKGYIHLSPAKCGY
FT                   QNPKWDKGVCNF"
     atgaaaaaag ctgtcttaat atttatttta ttcctgttgg ctggttgctc ctatcatgat        60
     gggtgctttt attctccaca actggttagc tgtgttgata aaggggaagt atttccatcc       120
     atatctcgct atcagaaacc gtatagttta ggaagaactg atagtaatca acgttggaaa       180
     gatgtaattt cttgtggtgg taaatatttg gattatgatc aaagaagtgt tcctttcgag       240
     aaacaagaag aattttatta ttgtatgctg ggtaaaggat atatccatct ttcccctgca       300
     aaatgtggtt atcaaaaccc taaatgggat aaaggggtat gtaatttcta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page