(data stored in ACNUC7421 zone)

EMBL: CP000947.PE272

CP000947.PE272       Location/Qualifiers
FT   CDS_pept        297372..297707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31905"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW81"
FT                   /protein_id="ACA31905.1"
FT                   /translation="MKVFSIISVVFLIGCSFGGFKPPKLHYKWRFEDKNFETSYEYAVF
FT                   RGKEMRSCGMDPVLGESVKLKVNLCMEKKGWYLEQGPVCEEKYVWNEPECIKWRAKHSK
FT                   PDAKPWE"
     atgaaagtat ttagtattat tagtgttgtc tttttgattg ggtgctcatt cggtggattc        60
     aaaccaccta agctacatta caagtggcgt tttgaagata aaaattttga aacatcttat       120
     gaatatgctg tttttagagg caaagaaatg cgatcttgtg gaatggatcc tgtattaggt       180
     gaaagtgtta aacttaaagt caatttgtgt atggaaaaaa aaggatggta tctagaacaa       240
     ggtccggtgt gtgaagaaaa atatgtatgg aatgagccgg aatgcattaa atggcgggct       300
     aaacacagta aacctgacgc gaagccatgg gaatag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page