(data stored in ACNUC7421 zone)

EMBL: CP000947.PE273

CP000947.PE273       Location/Qualifiers
FT   CDS_pept        298438..299547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0277"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_1345 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31906"
FT                   /db_xref="GOA:B0UW82"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW82"
FT                   /protein_id="ACA31906.1"
FT                   /translation="MTQQYALDTLLAQAGNRTDERTGAVSTPIFLSTAYAHHGIGESTG
FT                   FDYTRTKNPTRTVLEETIAKLEGGDRGFACSSGMAAIQLLMNLFASPDEWIVSSDVYGG
FT                   TYRLLDFAHKNIHGVKPVYVNTASSEEIEKAITENTKAIFVETPSNPLMEECDVAEIAK
FT                   IAKKYNLLLIVDNTFLTPVLFRPMEHGADIVIHSGTKYIAGHNDTLVGLIVAKGQEICD
FT                   RLYYIQNGAGPVLSPFDSWLTIRGMKTLALRMERHQKNAQELANFLREQPQVKDVLYPN
FT                   KGGMLSFRLQNENWVNPFLKAMKLITFAESLGGTESFITYPATQTHMDIPEVERVARGV
FT                   CNRLLRFSVGLENVEDIKADLLQAFSQLK"
     atgacacaac aatatgctct agatacatta ctggctcagg caggtaatag aacagatgaa        60
     agaaccggtg cggtatctac gccgattttt ctttccactg cttatgctca tcatggaatt       120
     ggtgaaagta cgggatttga ttatacccgc actaaaaatc caacgagaac ggtattagaa       180
     gaaacaattg caaaattaga aggtggagat cgtggatttg cctgttcttc aggaatggcg       240
     gctattcaat tattgatgaa cttatttgcg tcacctgatg aatggattgt ttccagcgat       300
     gtttatggcg gaacttatcg cctattggat tttgcacata agaatattca tggtgtcaaa       360
     cctgtttatg tcaatacagc ttcaagtgaa gaaattgaaa aggcaatcac tgagaataca       420
     aaggcgattt ttgttgaaac accatcgaat ccgttaatgg aagaatgtga tgtggcagaa       480
     attgcgaaaa tagctaaaaa atacaatttg ctattgattg tagacaatac ttttttaact       540
     cctgttttat ttagaccaat ggaacatggt gcagatattg ttattcatag tggaacaaaa       600
     tatattgctg gtcataatga cacattagta gggttaattg ttgccaaagg gcaagagatc       660
     tgtgaccgct tatattatat tcaaaatggt gcaggtcccg tattatcacc ttttgattct       720
     tggttgacca ttcgaggcat gaagacactt gcattgcgaa tggaacgtca tcagaaaaat       780
     gcacaggaat tggcaaactt tttaagagaa cagccacaag taaaagatgt gttatatcca       840
     aataaaggag ggatgctatc ttttcgtctt caaaatgaaa attgggtaaa tccttttctt       900
     aaagcaatga agttaattac ttttgctgag agtttaggcg gtacggaaag tttcattacg       960
     tatccggcga cacaaacgca tatggatatt cctgaggttg aacgtgttgc tcgaggtgta      1020
     tgcaatcgtt tactacggtt ttctgtagga ttggagaatg tagaagatat taaagcggat      1080
     ttattgcagg cattttctca actaaagtaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page