(data stored in ACNUC7421 zone)

EMBL: CP000947.PE274

CP000947.PE274       Location/Qualifiers
FT   CDS_pept        299712..300035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0278"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: hso:HS_1344 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31907"
FT                   /db_xref="GOA:B0UW83"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW83"
FT                   /protein_id="ACA31907.1"
FT                   /translation="MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEEL
FT                   SAELGDKVKIVKINIDENQATPAQFGVRSIPTLIFFKEGKAVATQVGALPKNQLVNFIN
FT                   QNS"
     atgagtgaag tattacatac aacagatgcg acttttgata ctgatgtatt aaaatcagat        60
     attccagtat tattagattt ttgggctcct tggtgtggtc cttgccgtat gattggacct       120
     attctagagg aactttcagc tgaattaggt gataaggtaa aaattgttaa aattaatatt       180
     gatgaaaatc aagcgacacc ggctcaattt ggtgtgcgta gcattccaac attaatattc       240
     ttcaaagaag gtaaggctgt cgcaactcag gttggtgcat taccaaaaaa tcaattagta       300
     aattttatca accaaaatag ctaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page