(data stored in ACNUC7421 zone)

EMBL: CP000947.PE275

CP000947.PE275       Location/Qualifiers
FT   CDS_pept        complement(300153..300848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0279"
FT                   /product="Chromosomal replication initiator DnaA"
FT                   /note="PFAM: Chromosomal replication initiator DnaA; KEGG:
FT                   hso:HS_1343 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31908"
FT                   /db_xref="GOA:B0UW84"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW84"
FT                   /protein_id="ACA31908.1"
FT                   /translation="MSQQLPLPIHQIDDDTLENFCSDNNLLLLGSLRKNFIQLYQPFFY
FT                   IFGGKSTGKTHLLKACSNYFLASQRNAIYIPLSKAQYFSPEVLENLEQQELVCLDDFHA
FT                   IIGNHEWELAIFDLMNRIKESGSTLLLISANQSPVNLNISLPDLASRLSWGEIYQLNPL
FT                   NEQQKVEVIKRNAHQRGIELPDDTANFLLKRLDRDIKSLFDTLTLLDKASLQAQRKLTI
FT                   PFVKEILNL"
     ttgagccaac aactcccttt gcctattcat cagatagacg atgatacctt agagaatttt        60
     tgtagcgaca ataatttatt gttactcggt tcattacgta aaaattttat tcaattatat       120
     caacctttct tttacatttt tggaggaaaa agtacaggta aaactcattt acttaaagca       180
     tgttccaatt attttttagc atcgcaacgc aatgcgattt atattccatt gagtaaagca       240
     caatattttt cccctgaagt tttggaaaat ttagaacagc aagagttggt ttgtttagat       300
     gatttccatg caataatagg aaatcatgaa tgggaattgg ctatttttga tttaatgaat       360
     agaataaaag agagcgggag tacattactg ttaataagtg ccaatcaatc tccagtgaat       420
     ttaaatatct ctttacccga tcttgcctca cgattaagtt ggggagaaat ttatcagcta       480
     aatccactaa atgaacaaca aaaagtagaa gtgataaaac gcaatgccca tcaacgaggg       540
     atcgaattac ctgatgatac agctaatttt ttattaaaac gtttagatcg tgatattaaa       600
     tctttatttg atacattaac tttattagat aaagcctcat tacaagcaca acgtaagttg       660
     actattcctt ttgtgaaaga aatattaaat ctttaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page