(data stored in ACNUC7421 zone)

EMBL: CP000947.PE278

CP000947.PE278       Location/Qualifiers
FT   CDS_pept        complement(303044..303871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0282"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   hso:HS_1340 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31912"
FT                   /db_xref="GOA:B0UW87"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW87"
FT                   /protein_id="ACA31912.1"
FT                   /translation="MCQLLGMNCNTPTDIVFSFEGFRRRAGLTNCHSDGFGIAFFEGKG
FT                   IRVFRDNRPGHSSPIADCIKQYNIKSLNVVAHIRKATQGEVNIENTHPFIRELWGENWV
FT                   FAHNGNLNSLPDMTESLFQPIGSTDSETAFCYMLSQLKKRFPKKPNEQDMFSAIQKLTQ
FT                   ELTRRGTFNFILSNGEWMMAHCSTNLHYLTRKAPFGKAQRIDDDNIIDFRDYAKETDKV
FT                   TIITTFPLTKDEHWNKMESGGFVMFKEGDKVAEILGIESEIIDDGTLGMQQFA"
     atgtgtcaac ttttaggaat gaattgtaat accccaacag atattgtttt ttcatttgag        60
     ggatttcgtc gaagagcagg attaactaat tgccattccg atggtttcgg aattgccttt       120
     tttgaaggaa aaggaattcg tgtttttcgc gacaatcgtc ccggacattc ttctcccatt       180
     gctgattgta ttaaacaata caacataaaa tctttaaatg ttgttgcaca tattcgtaaa       240
     gcaacacaag gagaagtcaa tattgaaaat actcaccctt ttattcgtga actttgggga       300
     gaaaattggg tttttgctca taatggcaac ttaaattcat tacccgatat gacagaaagt       360
     ctttttcaac cgataggctc gacggattcc gaaacagcat tttgttatat gcttagccaa       420
     ctaaagaaac gttttcccaa aaagcctaat gaacaagata tgtttagtgc aattcaaaaa       480
     ctcacacaag aattaacacg gagaggcaca tttaatttta tcctatctaa tggtgagtgg       540
     atgatggccc actgttcaac aaatttacac tatctcactc gtaaggcacc tttcggaaaa       600
     gcacaacgca tagacgatga taatattatt gattttcgtg actatgcaaa agaaacagat       660
     aaagtaacaa ttattacaac gttcccactt accaaagatg aacattggaa taaaatggaa       720
     tctggcggtt ttgtgatgtt taaagaaggt gataaagtag cagaaatctt aggcatagag       780
     tctgaaatta ttgatgacgg cacgctaggc atgcaacagt ttgcctaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page