(data stored in ACNUC7421 zone)

EMBL: CP000947.PE28

CP000947.PE28        Location/Qualifiers
FT   CDS_pept        22738..23601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0028"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: hso:HS_0162
FT                   GlpG protein, rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31909"
FT                   /db_xref="GOA:B0UUY6"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY6"
FT                   /protein_id="ACA31909.1"
FT                   /translation="MKLLFGSERENFIIWFRDYIRAKYLLELTIQNYIDEKYNRSVRGV
FT                   FIEENHPLLTQLEQEKILFLQDPFNPCYQQAAWEAGDTHSIQYKKTSWVAIWKISSKWF
FT                   QQGKITLFITALCTLIYVLQNLGFEQGIFYFAHYPANPAQQTEIWRYISHSLVHLSPLH
FT                   FLFNLSWFWLFGGAIERQLNAKKLLLLFFVSSILTGVVQNYFSDYRFFGLSGVVYAVLG
FT                   YVFILDKFHYAKFALPSGFFLMLIMGIALGFISPLVGIYMGNSAHISGLLCGILLGLWQ
FT                   VKKREF"
     atgaaactat tatttggtag tgaaagagag aattttatta tttggtttcg tgattatatc        60
     cgagctaagt atttgcttga attgaccatt caaaactata ttgatgaaaa atataatcgg       120
     tcggtgcgtg gtgtttttat cgaagaaaat catccattat tgacacagct tgaacaagag       180
     aaaatacttt ttctgcagga tccttttaac ccttgttatc agcaggcagc ttgggaagcc       240
     ggcgatacac attccattca gtacaaaaaa acatcatggg tggctatttg gaaaatctca       300
     tcgaaatggt tccaacaagg taaaataact ttatttatta ccgcactttg cactctaatt       360
     tacgttttac agaacttggg atttgagcaa ggtattttct attttgctca ttatccagca       420
     aatccggcac aacaaacaga aatttggcgt tatatttcgc atagtttagt gcatctctcg       480
     ccactacatt ttttatttaa tctaagttgg ttttggttat ttggcggggc aattgaacga       540
     cagctgaatg caaaaaaatt actgttgctc ttttttgttt catctatttt gaccggagtc       600
     gtgcaaaatt atttctctga ttatcgtttc ttcgggttat ctggtgtagt ttatgcggta       660
     ttgggttatg tatttatttt agataaattt cattatgcta aatttgcttt accatcaggt       720
     tttttcttga tgttaattat ggggatcgcc ttaggtttta ttagtccgct tgtaggtatt       780
     tatatgggca acagtgctca tattagtggt ttattatgtg ggattttatt aggcttatgg       840
     caagttaaaa aaagggagtt ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page