(data stored in ACNUC7421 zone)

EMBL: CP000947.PE281

CP000947.PE281       Location/Qualifiers
FT   CDS_pept        complement(307235..309025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0285"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   TIM barrel; glycoside hydrolase family 2 sugar binding;
FT                   KEGG: hso:HS_1330 beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31915"
FT                   /db_xref="GOA:B0UW90"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW90"
FT                   /protein_id="ACA31915.1"
FT                   /translation="MLYPTLTKTRSLYDLSGLWQFKLGEHNPEKDLSPEEVMVVPTSFN
FT                   DVVVDKDKRNYIGDFWYERWVDIPKLAENDELVLRFGSVTHNAKIYVNGRELASHKGGF
FT                   TPFEVIIPEELYQENQIKISVCANNILDYTTLPVGNYIEETQEDGSIKKVVKENFDFFN
FT                   YAGIHRPVKLMVRPKIHISDVTIVSELSDDLKTAKLSIAVETSKAVDTIQVTILDEDRQ
FT                   VVAQSSNGHITLEQVRLWEVLDAYLYTAHIELLVDGKVVDTYDEPFGVRSVHVADGQFF
FT                   VNQKPVYFKGFGKHEDTFINGRGLNEAANLMDMNLLKEIGANSFRTSHYPYSEEMMRLA
FT                   DRMGVLVIDEIPAVGLFQNFTASLDLNPKDNGTWSAMKTREAHEQAIQELVKRDKNHPS
FT                   VVMWVVANEPASHEAGAHDYFKPLVALYKELDPQKRPVTLVNILLATPERDEVMDLVDV
FT                   ISLNRYYAWYVDHGDLAKGEAGLRQELLKWQSKFPDKPILMTEYGADTLPGLHSMWDIP
FT                   YTEEFQCDFYAMSHSVFDSIPNLVGEQVWNFADFETNLMIYRIQGNHKGLFSRNRQPKQ
FT                   VVKEFKKRWTAIPNYNYKKK"
     atgttatatc caacgttaac aaaaacaaga agtttatatg accttagtgg tttatggcaa        60
     tttaaactag gagagcataa tcccgaaaag gatttatcac cagaagaagt gatggtagta       120
     ccaacttcct ttaatgacgt ggtggttgac aaagataagc gtaattatat tggagatttt       180
     tggtatgagc gttgggtgga tattcccaaa ttagcggaaa atgatgagtt agttttacgc       240
     tttggttcgg taactcacaa tgccaaaatt tatgttaacg gtcgagaact tgcttctcat       300
     aaaggtggat tcactccgtt tgaggtaatt attccagagg agctttacca agaaaatcaa       360
     ataaaaatct ctgtctgtgc caataatatc ttagattaca ccacccttcc tgttggtaat       420
     tacattgaag agactcaaga agatggcagt attaaaaaag tggttaaaga aaactttgac       480
     ttcttcaact atgcaggaat tcatcgccca gtaaaattaa tggtacgtcc taaaattcac       540
     atttcagatg ttaccatcgt cagtgagctt tcagatgact taaagacggc aaaactttct       600
     attgctgttg aaacatcaaa ggcagttgac acaatccaag taactattct tgatgaagat       660
     cgtcaagtag ttgcacaatc aagtaacggg catatcactc tcgaacaagt acgcttatgg       720
     gaagttttag atgcttatct ttataccgca catattgagc tacttgttga tggtaaagtt       780
     gttgatacct atgatgagcc atttggtgta cgtagtgttc atgtggcaga tggtcaattc       840
     tttgtcaatc aaaaacctgt ttattttaaa ggttttggaa aacatgaaga tacttttatc       900
     aatggtcgcg gtttaaacga agcagcaaac ttgatggata tgaacctttt gaaagaaatt       960
     ggtgccaact ctttccgaac ctcacactat ccttattctg aagaaatgat gcgtcttgca      1020
     gatcgcatgg gagttttggt aattgatgaa attccagccg ttggactttt ccaaaacttt      1080
     accgcttctc ttgatttaaa tcccaaagat aacggaactt ggtctgctat gaaaacccga      1140
     gaagcacatg aacaagcgat tcaagaattg gtaaaacgtg ataaaaatca cccttcagtt      1200
     gtcatgtggg tagtagcaaa tgaaccagcc agccatgaag caggtgctca tgattatttc      1260
     aaaccattag ttgctcttta taaggaattg gatccgcaaa aacgtcctgt taccttagtc      1320
     aatattttac tggcaacgcc agagcgtgat gaagtaatgg atttagtaga tgtcatttct      1380
     ttgaatcgat actatgcttg gtatgtagat catggtgatt tagctaaagg agaagctgga      1440
     cttcgtcaag agttgttaaa atggcaaagt aaattcccag ataaaccaat tcttatgaca      1500
     gaatatggtg cagatacttt acctggctta cattctatgt gggatattcc ttataccgaa      1560
     gagtttcaat gtgattttta tgctatgagc catagtgttt ttgacagcat ccctaatctt      1620
     gttggggaac aagtatggaa ttttgcagac tttgaaacaa accttatgat ttaccgtata      1680
     caaggaaacc ataaagggct tttctcacgc aatcgtcaac caaaacaagt cgttaaagaa      1740
     ttcaaaaaac gctggaccgc tattccaaac tacaattaca agaaaaagta a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page