(data stored in ACNUC7421 zone)

EMBL: CP000947.PE282

CP000947.PE282       Location/Qualifiers
FT   CDS_pept        complement(309047..310075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0286"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_1329
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31916"
FT                   /db_xref="GOA:B0UW91"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW91"
FT                   /protein_id="ACA31916.1"
FT                   /translation="MKTVVSLGEILLRLSPPQYQTLTLTTSLECQFGGSELNVLSTLAQ
FT                   LGHNVSLISAIPDNDLGRMTKNFLFSRQINQDYILEKGQRLGIYYYQKGFSLRASRVTY
FT                   DRKHSAFWESQLSDYDLESVFKGADWFHVSGITPALNDNLYSLTHYLMTKAKAEGLTVS
FT                   FDLNFRASLWNSFQEARELLSPLAALADVCIGIEPLSLSGDGQGDLKDQLGLTRPYEDQ
FT                   ELLKSILDKLAKTYSVKSFAFTQREMGHTNEYLLKGYLYQDGHLYQTDKSGIQVLDRVG
FT                   TGDAFTAGIIHGMLKKESPEKSLAIAMASFKFKHTIEGDINVISQADIDQLLDETSHEI
FT                   KR"
     ttgaaaacag tagtttcttt aggtgaaatc ttgttacggt tatcaccacc acagtatcaa        60
     accctaacac tgacaaccag tctagaatgt caatttggcg gttcagaatt aaatgttctt       120
     tcaaccttgg cacaattagg acacaacgtt tctcttatat ctgccattcc ggataatgat       180
     ttaggtagga tgacgaaaaa ctttcttttt tctcgtcaaa tcaatcagga ttacattttg       240
     gaaaaagggc aacgtctagg gatttattat taccagaaag gcttttcctt acgtgccagt       300
     cgggtaactt atgaccgaaa acactctgct ttttgggaat ctcaactgag tgattatgac       360
     ctagagtctg tattcaaagg agccgactgg tttcatgtgt ctggcatcac tccagcgttg       420
     aatgataacc tttatagctt aacccattat ttgatgacca aggctaaagc agagggactc       480
     actgtctctt ttgatttaaa ttttagagca agtttatgga actctttcca agaggcaaga       540
     gaattattgt cccctcttgc cgctctagca gatgtttgca ttggaattga gccgttaagt       600
     ctttccggtg atgggcaagg agatttaaaa gaccaattag gtttaacaag accttacgaa       660
     gatcaagaat tattaaaaag cattttggat aaattagcta aaacttatag cgtgaaaagc       720
     tttgctttta ctcaaagaga aatgggacat actaatgaat atctattgaa aggctattta       780
     tatcaggatg gtcatcttta tcagacagac aaatcaggca ttcaagtgtt agaccgtgtt       840
     ggtactggag acgcttttac agcgggaatt attcatggca tgcttaaaaa agaaagtcct       900
     gaaaaaagtt tggccattgc tatggcaagt ttcaagttca aacataccat tgaaggcgat       960
     attaatgtga tttctcaagc agatattgat caattgctag atgagacttc ccacgagatt      1020
     aaacgttaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page