(data stored in ACNUC7421 zone)

EMBL: CP000947.PE285

CP000947.PE285       Location/Qualifiers
FT   CDS_pept        313439..313972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0289"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   hso:HS_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31919"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW94"
FT                   /protein_id="ACA31919.1"
FT                   /translation="MAKCKEEVFNWEDEEQEEIIWVSKSEIKRDAEALKKLGEKLVNLT
FT                   KTNLDKIPLDTGLRDAVELAQRLQKEALRRQIQYIGKLLRAIDPEPIQEALNKIENKHQ
FT                   QQQAKLHKLELLRDELVQKGNSAFTELLIQYPHADRQHLHNLIRSAQKEREQNKPPKSY
FT                   REIFQYLKDLILED"
     atggcgaaat gtaaagaaga agtgtttaat tgggaagatg aggaacaaga agaaattatt        60
     tgggtgagta aaagtgaaat aaaacgtgat gcggaagctt tgaaaaaatt aggtgaaaaa       120
     ctcgtcaatt taaccaaaac aaatttggat aaaataccat tagacacagg gttgcgtgat       180
     gcggtcgaac ttgcacaacg tttgcaaaaa gaagctcttc gccgtcaaat tcaatatatc       240
     ggcaaactct tgcgagccat tgatccggaa ccaatccaag aagcgttaaa taaaattgaa       300
     aataaacatc agcagcaaca agcaaaatta cataaattag aattattacg agatgaattg       360
     gttcaaaaag gcaacagtgc atttacagag ctattaatac agtatcctca tgcagatcgc       420
     caacatttac ataacctaat tcgttcagca caaaaagagc gggaacaaaa caaaccacct       480
     aaatcatacc gagaaatttt ccaatatttg aaagatctga ttttggaaga ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page