(data stored in ACNUC7421 zone)

EMBL: CP000947.PE286

CP000947.PE286       Location/Qualifiers
FT   CDS_pept        314103..315638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0290"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1325 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31921"
FT                   /db_xref="GOA:B0UW95"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW95"
FT                   /protein_id="ACA31921.1"
FT                   /translation="MTTPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGQ
FT                   AHFNGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIEEADIVLFLVDARAGLTSADVGIA
FT                   QYLRKRQNKTTVLVANKTDGIDADSHCAEFYQLGLGEIEKIAASQGRGISALMEKVLPP
FT                   VADKLSLANAEEHSESAVENSDESAEEWEKDFNFNSEEDIQLLDEALVEEQEESEDKNI
FT                   KIAIVGRPNVGKSTLTNRILGEDRVVVYDLPGTTRDSIYIPMERDGQQYTLIDTAGVRK
FT                   RGKVHLTVEKFSVIKTLQAIQDANVILLTIDARQGISDQDLSLLGFILNTGRSLVIVVN
FT                   KWDGLNQDIKDQVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATKKMT
FT                   TSLLTRILQMATDEHQPPMIGGRRIKLKYAHPGGYNPPIIVVHGNQIEGLPDSYKRYLS
FT                   NYYRRSLKIIGSPIRLLFQEGNNPFAGRRNKLTPNQLRKRKRLMKFIKKSKQR"
     atgactactc cagtagttgc tctagtcggt cgccctaatg tcggtaaatc gactttattt        60
     aatcgtctaa cacgtactcg tgatgcttta gtggctgatt ttcccggtct tactcgggat       120
     cgaaaatatg gtcaagcaca tttcaatggt tatgacttta ttgtgattga tacgggaggt       180
     attgatggga cggaagaagg cgtagaggaa aaaatggcgg agcaatcctt acttgccatt       240
     gaagaagccg atattgtttt atttcttgta gatgctcgtg ctggcttaac ttctgcggat       300
     gttggtattg ctcaatattt gcgtaaacgc caaaataaaa ctactgtact tgtggcaaac       360
     aaaaccgatg gtattgatgc agattctcat tgtgcagagt tttatcaact aggcttgggt       420
     gaaattgaaa aaattgcggc atcacaagga cgcggtataa gtgcattaat ggaaaaagtt       480
     ttgccacctg ttgccgacaa gctaagttta gctaacgcag aagagcattc agaaagtgcg       540
     gtagaaaatt cagatgaaag tgcggaagaa tgggaaaaag attttaattt taatagtgaa       600
     gaagatatac agctacttga tgaggctctt gtagaagaac aagaagaaag tgaagataaa       660
     aatatcaaaa ttgccattgt gggtcgtcca aatgtaggaa aatcaacact aactaaccgc       720
     attttaggtg aagatcgtgt agtggtgtat gacttaccgg ggaccactcg agacagcatt       780
     tatattccga tggagcgaga tggtcagcaa tacactctca ttgatacggc cggtgtacgc       840
     aaacgtggta aagttcattt aacagtagaa aaattctctg ttatcaaaac attacaagct       900
     attcaagatg cgaatgttat tttgttgacg attgatgctc gtcaaggcat atccgatcaa       960
     gatttatcgt tattaggttt cattttaaat accggtcgtt ccttggtcat tgttgtcaat      1020
     aaatgggacg gtttaaatca agatataaaa gatcaagtca agtctgaatt ggatcgtcgt      1080
     ttagacttta ttgattttgc acgtgttcat tttatttctg ctctacatgg tagtggtgta      1140
     ggcaatttat ttgacagtat aaaagaggct tatgcttgtg ctacaaaaaa aatgacaacg      1200
     tcattactaa cccgcattct acaaatggca acagatgaac atcaaccgcc aatgataggt      1260
     ggacgcagaa ttaaactaaa gtatgcacat ccaggcgggt ataatccacc aattattgtt      1320
     gtacacggca atcaaatcga aggtttgccg gacagctaca aacgatattt atctaactat      1380
     taccgtcgta gcttaaaaat tattgggtca ccgattcgtt tattgttcca agaaggaaac      1440
     aacccgttcg cagggcgtcg taataaactg acaccaaatc agttgcgtaa acgtaaacgt      1500
     ttgatgaaat ttatcaaaaa atcaaaacag cgataa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page