(data stored in ACNUC7421 zone)

EMBL: CP000947.PE29

CP000947.PE29        Location/Qualifiers
FT   CDS_pept        23818..24342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0029"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   hso:HS_0163 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31920"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY7"
FT                   /protein_id="ACA31920.1"
FT                   /translation="MQKVKLPLTVDPIKDAQRRLDYQGCYVSNQVTRLAESVVKVLSDV
FT                   QVTLSFFVDPQKLTVMKGRASVDVELECQRCGCPFSQSLECEFSYSPVSDLGKINELPE
FT                   IYEPIELNEFGEIDLIGTVEDELIVALPIVPMHSSEHCEVSVAEQVFGELPEELAKKPN
FT                   PFAVLASLKKK"
     atgcaaaagg taaaactacc cctaactgtt gacccgatta aagatgcaca gcgtagattg        60
     gattatcaag gttgttatgt gtccaatcaa gttactcgtt tagcggagtc agtagtcaaa       120
     gtgctcagcg atgtgcaggt aacattatcg tttttcgttg atccgcaaaa attgactgta       180
     atgaaaggaa gagcgagtgt tgatgtggaa ttagaatgtc aacgttgtgg ttgtcctttc       240
     agtcaatcat tggaatgtga gttttcttat agtccagtgt ctgatttggg taagatcaat       300
     gaattgccag agatttatga accgatagaa ttaaatgaat tcggggaaat agatttaatt       360
     ggaacggttg aagatgaact gattgttgct cttccaattg ttccgatgca ttcatctgaa       420
     cactgtgaag tgtccgtggc tgaacaggtt tttggcgaat tgccggaaga gctggcaaaa       480
     aaaccgaacc cgttcgctgt attagctagt ttaaagaaaa agtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page