(data stored in ACNUC7421 zone)

EMBL: CP000947.PE3

CP000947.PE3         Location/Qualifiers
FT   CDS_pept        2762..3838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: hso:HS_0138 DNA replication
FT                   and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31931"
FT                   /db_xref="GOA:B0UUM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUM0"
FT                   /protein_id="ACA31931.1"
FT                   /translation="MAISRLIINHFRNLTAIDLEFERGFNFIIGNNGSGKTSLLEAIFY
FT                   LGHGRSFKSAVANRIISYQQPHFILHGKIQEQQHQWSVGLQKQRQGNTLMKINGEDAKK
FT                   ISDLAHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHHNASFYNAWSSLNRLLKQRNS
FT                   ALQQVCSYEKLKIWDRELTKLAYQVSYWREAYAEALRSEIEKTCQLFLPELEISVSFHQ
FT                   GWDKNMDYADLLQQNFERDRALGYTFSGPQKADFRFKANGLPVEDILSRGQLKLLMCAL
FT                   RLAQGEHLMQQKKRHCIFLLDDFASELDQYKRTLLAERLQKNGSQVFVTAITREQLQQI
FT                   QPEKHRTFYLENGRIKDL"
     atggcaatat cacgcttaat catcaatcat ttccgcaact taacagccat agatctggaa        60
     tttgaacgtg gctttaactt tattatcggc aacaatggaa gcgggaaaac aagtttactg       120
     gaagctattt tttatttagg gcacggacgc tcatttaaaa gtgcggttgc aaatagaata       180
     atttcttatc agcaaccgca ctttatttta catggtaaaa ttcaagagca acaacatcaa       240
     tggtctgttg gtttgcaaaa acaacgtcaa ggtaacactt taatgaaaat aaacggcgag       300
     gacgcaaaaa aaatttccga tcttgcccat ttattgccca tgcaactcat tacacctgaa       360
     ggattaacct tattaaatgg cggtcccagc tatcgaaggg cttatttaga ttgggggtta       420
     tttcatcata acgcatcatt ttataatgct tggagtagct taaatcgttt acttaaacaa       480
     cgaaattctg ccttacaaca agtttgttct tatgaaaaac tcaaaatttg ggatagagaa       540
     ttaaccaaac ttgcttatca agtgagctac tggcgagaag cgtatgcgga agccttacgc       600
     tcggaaatag aaaaaacctg tcagcttttt ctacctgaac tagaaatttc tgttagcttt       660
     catcaaggct gggataaaaa tatggactat gcggatctgt tacaacaaaa ctttgagcga       720
     gatcgtgctt tgggttatac cttttccgga cctcaaaaag cagattttcg ttttaaagca       780
     aacggattgc cggttgaaga tattttatct cgtggacaat taaaattgtt aatgtgtgca       840
     ttacgtttgg ctcaaggtga gcatttaatg caacaaaaaa aacgccactg tatttttcta       900
     cttgacgatt tcgcttcaga attggatcaa tataaacgca cattgcttgc tgaacgctta       960
     caaaaaaatg gttcgcaagt ttttgttact gcaataactc gagaacaatt acaacagata      1020
     caaccagaaa agcaccgcac tttttacctt gaaaacggaa gaataaaaga tctttaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page