(data stored in ACNUC7421 zone)

EMBL: CP000947.PE31

CP000947.PE31        Location/Qualifiers
FT   CDS_pept        24651..24929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0031"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="KEGG: hso:HS_0164 possible fatty acid/phospholipid
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31943"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY9"
FT                   /protein_id="ACA31943.1"
FT                   /translation="MLSLLFANNQQNFPLRQRFPIDSQNYLAVCHCSHVIENNQGLVHT
FT                   LVHIFVEYQLGLFYLYAALLNIGIEETKEYKEYKAIRDMALQSSKKG"
     atgctgtctt tgttgtttgc taataaccaa caaaattttc ctctacgtca acgttttcca        60
     atcgatagtc aaaattattt agccgtctgt cattgctctc atgtgattga aaataatcag       120
     ggtttagttc ataccttagt tcacattttt gtagaatacc agctaggttt attttatcta       180
     tatgcagctt tgttaaatat aggtattgag gaaaccaaag aatataaaga atataaagct       240
     attcgagata tggcattaca atcttcaaag aaaggttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page