(data stored in ACNUC7421 zone)

EMBL: CP000947.PE32

CP000947.PE32        Location/Qualifiers
FT   CDS_pept        24982..25932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0032"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; KEGG: hso:HS_0165
FT                   3-oxoacyl-[acyl-carrier-protein] synthase
FT                   (beta-ketoacyl-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31952"
FT                   /db_xref="GOA:B0UUZ0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ0"
FT                   /protein_id="ACA31952.1"
FT                   /translation="MYSRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIA
FT                   GENETVATMGFEAAKNALQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAI
FT                   SFDLAAACTGFIYALSVADQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGA
FT                   VILESSDIEGIISTHLHASLDKSNALILPQTQQGEVQSGYIQMQGNATFKLAVRELSNV
FT                   VEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPV
FT                   ALDEAVRDGRIKRGQLLLLEAFGGGWTWGSALVRF"
     atgtacagta gaattttagc aaccggtagt tatataccgg ctaatatcag gactaatgct        60
     gatttagaaa aaatggtaga gacatctgat gaatggatta ctactcgttc cggtataaaa       120
     gagcgtcgta tcgccggtga aaatgaaaca gttgccacaa tgggatttga ggccgctaaa       180
     aatgcacttc agttagccaa tatttgccct aacgatatcg atttggtttt ggttgcgact       240
     accagccact cctatgctta tccaagtgct gcatgccaaa ttcaaggtat gttggacatt       300
     gatgatgcaa tttctttcga tttggcggca gcttgcacgg ggtttatcta tgctttaagt       360
     gttgcagatc aattcattaa aacaggtaaa gtaaaaaaag ctttagtgat tggtgcagat       420
     attaattctc gtaagttaga tgaaacggat cgtagcactg ttattttatt tggtgacggt       480
     gctggtgccg tgatcttgga aagcagcgat attgaaggga ttatttctac tcatttacat       540
     gcttctttag ataaaagtaa cgccttaatt cttcctcaaa ctcaacaggg tgaagtacaa       600
     tccggttata ttcaaatgca agggaatgca acttttaaac ttgcagtacg agaattatct       660
     aatgtagtag aagaaacttt acgtgataat cacttagaca aagctgattt agattggttg       720
     gtacctcatc aagcaaactt acgtattatc acggcaactg ctgaaaaatt gaatatgtct       780
     ttagatcaag tggtaattac tttagacaag tacggtaata caagtgcggc gacagtacct       840
     gtggcattgg atgaagctgt acgtgacggg cgtattaagc gtggtcaatt attattatta       900
     gaagcatttg gtggcggttg gacttggggt tctgcgttgg ttcgtttcta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page