(data stored in ACNUC7421 zone)

EMBL: CP000947.PE33

CP000947.PE33        Location/Qualifiers
FT   CDS_pept        25976..26914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0033"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: hso:HS_0166
FT                   [acyl-carrier protein] S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31963"
FT                   /db_xref="GOA:B0UUZ1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ1"
FT                   /protein_id="ACA31963.1"
FT                   /translation="MKKFAMVFPGQGSQAVGMLAELATEYPIVEETFQQASSVLGYDLW
FT                   QLVQQGPAEELNKTWQTQPALLAASVAIYRVWQQKYPYLKPEVMAGHSLGEYSALVCAG
FT                   VIDFQDGIKLVQLRGKLMQQAVPEGTGAMYAIIGLDNESIVQACKASEQGEIVSAVNFN
FT                   SPGQVVIAGAKVAVERAAVACKEAGAKRALPLAVSVPSHCALMKPAAEELAVALEKMTF
FT                   SIPQIPVINNVDVKAENETTKIRTALVRQLYSPVRWTEIVENMAREGIELLFEMGPNKV
FT                   LTGLTSRIAKELNAKAVNDLSSLNTVEESLD"
     atgaaaaaat ttgcaatggt tttccctgga caaggctcac aagcagtggg aatgctggct        60
     gaattggcta cagaatatcc gattgttgaa gaaacttttc agcaagcttc ctccgttttg       120
     ggttatgatt tatggcagtt agtgcaacaa ggtcctgcag aagaattgaa taaaacgtgg       180
     caaacacaac ccgcactttt agctgcttcc gtggcaattt atcgtgtatg gcaacaaaaa       240
     tatccttacc taaaacctga agtgatggca ggacatagtt taggtgaata ttccgcttta       300
     gtatgtgccg gtgtaattga tttccaagat ggaattaagt tggtacaact tcgtggtaag       360
     ttaatgcaac aagcagttcc ggaaggaaca ggtgccatgt acgcaattat aggtttagat       420
     aatgaaagca ttgttcaagc ttgcaaagcg tctgaacaag gtgagattgt gtcagcggta       480
     aactttaatt caccgggaca agtggtgatt gcaggagcaa aagtcgcagt agaacgtgct       540
     gctgttgctt gtaaagaggc gggagcaaaa cgtgcgttgc cgttagcagt cagcgtgcct       600
     tctcactgtg cattaatgaa accagcagca gaagaattgg cagtagcgtt agaaaaaatg       660
     acgtttagca tcccacaaat tccggttatt aataatgttg atgtgaaagc agaaaatgaa       720
     accactaaga ttcgtaccgc acttgtgcgt cagctttata gtcctgtacg ttggactgaa       780
     atagttgaga atatggcaag agagggaatt gaacttttat ttgagatggg acctaataag       840
     gtgctcactg gattaactag tcgtattgct aaagagttga atgctaaagc agtcaatgat       900
     ttatcttcat tgaatacagt ggaagaaagc ttagattaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page