(data stored in ACNUC7421 zone)

EMBL: CP000947.PE34

CP000947.PE34        Location/Qualifiers
FT   CDS_pept        26968..27693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0034"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; KEGG: hso:HS_0167 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31974"
FT                   /db_xref="GOA:B0UUZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ2"
FT                   /protein_id="ACA31974.1"
FT                   /translation="MQGKIALVTGATRGIGRAIAEELASKGAFVIGTATSEKGAESISA
FT                   YLGKQGKGLVLNVADQDSIDAVLSAIKAEVGDVEILVNNAGITRDGLLMRMKDDDWFDI
FT                   MQTNLTSIYRLSKAVLRPMMKKGGRIINIGSVVGSMGNPGQTNYCAAKAGVIGFTKSLA
FT                   KEVAARGVTVNVVAPGFIATDMTDVLTDEQKANILTNVPASRLGQPKDIAKAVAFLASE
FT                   DASYITGTTLHVNGGMYLP"
     atgcaaggaa aaatagcatt agtaacaggt gctacacgtg ggattgggcg tgcaatagca        60
     gaagaattag cgagcaaggg ggcttttgtt attggtactg caacaagcga aaaaggagcg       120
     gaaagtattt ctgcttattt aggcaaacag ggtaaaggtt tggtattaaa tgtcgcagat       180
     caagattcaa tagatgctgt attgagtgcc attaaagctg aagtgggtga tgttgagatt       240
     ctagtgaata atgcaggaat tacccgtgat ggtttattaa tgcgtatgaa agatgatgac       300
     tggtttgata ttatgcaaac taatttaacg tctatctatc gtttatctaa agctgtatta       360
     cgtccgatga tgaaaaaagg tggacgcatt attaatattg gttcagtagt tggctcaatg       420
     ggaaatcccg gtcaaactaa ctattgtgcg gcaaaagcgg gtgttattgg ctttacaaaa       480
     tcgttagcaa aagaagttgc agcaagagga gtaactgtga atgttgtagc tccaggtttc       540
     attgcaacag atatgacgga tgtgttaact gacgagcaaa aagcaaatat tctgacaaat       600
     gtgccggcaa gtcgtttggg acagcccaaa gatattgcga aagctgttgc atttttggca       660
     tcggaggatg cgtcatatat tacaggtact acattacatg ttaacggtgg aatgtattta       720
     ccttag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page