(data stored in ACNUC7421 zone)

EMBL: CP000947.PE36

CP000947.PE36        Location/Qualifiers
FT   CDS_pept        28327..28755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0036"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: hso:HS_0169 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31996"
FT                   /db_xref="GOA:B0UUZ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ4"
FT                   /protein_id="ACA31996.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSSKPNKDKVGKVTLD
FT                   QIRQIAETKAADMTGATIETKMKSIEGTARSMGLVVEG"
     atggcaaaaa aagtccaagc atacgttaag ttgcaagtcg cagcaggtat ggctaaccca        60
     tcaccacctg ttggtcctgc attaggtcaa caaggtgtga acatcatgga attctgtaaa       120
     gcatttaatg ctcgtactga gagtctagag aaaggtttac cgattcctgt cgttattact       180
     gtttatgcag accgctcttt tacatttgtg actaaaactc cgccggcagc ggtattattg       240
     aaaaaagctg ctggaattaa atctggttct agtaaaccta acaaagataa agtaggtaaa       300
     gtcactttag atcaaatccg tcaaattgct gaaactaaag cagccgatat gaccggtgca       360
     acaattgaaa ctaaaatgaa atctattgaa ggtacagcac gttcaatggg tttagtagtg       420
     gagggttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page