(data stored in ACNUC7421 zone)

EMBL: CP000947.PE37

CP000947.PE37        Location/Qualifiers
FT   CDS_pept        28760..29449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0037"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: hso:HS_0170 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32007"
FT                   /db_xref="GOA:B0UUZ5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ5"
FT                   /protein_id="ACA32007.1"
FT                   /translation="MAKLTKRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDSAKAAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGV
FT                   AVDQSSL"
     atggctaaac ttactaagcg tatgaaagca atcaaagccg gtgttgattc aacaaaacaa        60
     tatgaaatca atgaagctat tacggtgttg aaacaattca cttcaacaaa attcgttgaa       120
     agcgttgacg ttgcagtcaa tttaggtatt gatgcacgta aatcagatca aaatgtacgt       180
     ggtgcaaccg tgttaccaca tggtacaggt cgttcagtac gtgttgctgt gtttactcaa       240
     ggtgctaatg ttgattcggc taaagcagct ggtgctgatt tagtagggat ggaagattta       300
     gcagagcaaa tcaaaaaggg tgaaatgaac tttgatgttg ttattgcttc ccctgatgca       360
     atgcgtgttg ttggtcaact aggtcaaatt ttagggccta gaggcttaat gccaaatcct       420
     aaagttggta ccgttacacc aaacgttgct gaagcggtta aaaatgctaa gtccggtcaa       480
     atccgttacc gcaatgataa aaacggtatt attcatacta caatcggtaa agcaaatttc       540
     tctgctgaac aattaaaaga aaacttacaa gcattattag ctgccttgac taaggcgaag       600
     cctgcgacag caaaaggtat ctttattaga aaagtaagtg tttctactac tcaaggtgca       660
     ggcgttgctg ttgatcaaag tagcttataa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page