(data stored in ACNUC7421 zone)

EMBL: CP000947.PE38

CP000947.PE38        Location/Qualifiers
FT   CDS_pept        29733..30224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0038"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: hso:HS_0171 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32018"
FT                   /db_xref="GOA:B0UUZ6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ6"
FT                   /protein_id="ACA32018.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAA
FT                   REAGVSMRVVRNTLLRRAVEGTDFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKAND
FT                   KFEIKGAAFEGKIQNVEFLATLPTYEEAIARLMGTMKEAAAGKLARTLAAYRDKLQEAA
FT                   "
     atggcattaa atcttcaaga caaacaagca attgttgctg aagtaaatga agcagccaaa        60
     ggtgccctat cggcagttat tgcggattct cgtggtgtta ctgttgataa aatgactgag       120
     ttacgtaaag cagctcgtga agctggcgtt tctatgcgtg ttgtacgtaa tactttatta       180
     cgtcgtgcag tagaaggcac agattttgag tgcttaacag atacgtttgt aggtccaaca       240
     cttatcgcat tttctaatga gcatccaggt gcggctgcac gtttgttcaa ggattttgct       300
     aaagctaacg ataagtttga aattaaaggt gcagcctttg aaggtaagat ccaaaatgtt       360
     gagttcttag caacattacc gacttacgaa gaagcaattg cacgtttaat gggtactatg       420
     aaagaagcag cggcaggcaa acttgctcgc actcttgcgg cataccgcga caaattacaa       480
     gaagcggctt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page