(data stored in ACNUC7421 zone)

EMBL: CP000947.PE39

CP000947.PE39        Location/Qualifiers
FT   CDS_pept        30276..30644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0039"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: hso:HS_0172 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32029"
FT                   /db_xref="GOA:B0UUZ7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ7"
FT                   /protein_id="ACA32029.1"
FT                   /translation="MSLTNEQIIEAIASKTVTEIVELISAMEEKFGVSAAAAAVAVAAG
FT                   PAEVAEEKTEFDVVLAEAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAE
FT                   AEALKKELEEAGAKVEIK"
     atgtcattaa ctaacgaaca aatcattgaa gcgattgctt caaaaactgt cactgaaatc        60
     gtagaattaa tttctgcaat ggaagaaaaa tttggtgttt ctgctgcggc agcagcggta       120
     gcagtagctg ctggtccagc tgaagtagct gaagaaaaaa ccgaattcga tgtggtttta       180
     gctgaagctg gtgctaataa agtagctgta attaaagcag tacgtggtgc gactggttta       240
     ggcttaaaag aagctaaaga cctagtagaa tctgctccgg ctaacttaaa agaaggtatt       300
     tctaaagcag aagctgaagc acttaagaaa gaattagaag aagctggtgc gaaagtagaa       360
     atcaaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page