(data stored in ACNUC7421 zone)

EMBL: CP000947.PE4

CP000947.PE4         Location/Qualifiers
FT   CDS_pept        complement(3895..4539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0004"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: hso:HS_0139 catabolite gene activator (cAMP
FT                   receptor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32040"
FT                   /db_xref="GOA:B0UUM1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM1"
FT                   /protein_id="ACA32040.1"
FT                   /translation="MLEQQGQSAPSMDPTLEWFLSHCHIHKYSAKSSLIHAGEKAETLY
FT                   YLIRGSVAVMVKDEEGKEMILTYLSQGDFFGEAGLFDETQPRSAWVKAKSSCEIAEISY
FT                   KKFRQLIQVNPEILMYLAGQLAHRLQNTSKQVSNLAFLDVTGRIAQTLLNLAKMPDAMT
FT                   HPDGMQIKITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVVYGTR"
     atgttagaac aacaaggaca atcagcacca tcgatggatc cgacgttaga gtggttccta        60
     tctcattgtc acattcataa atactcagca aaaagctccc tcattcatgc tggagaaaag       120
     gcggaaaccc tttattattt aattagaggg tctgttgccg tgatggtaaa agatgaggaa       180
     ggtaaagaaa tgattttgac ttatttaagt caaggtgatt tttttggcga agctggttta       240
     tttgatgaaa cacagcctcg ttcggcttgg gttaaagcta aaagctcatg tgaaattgca       300
     gaaatttctt ataaaaaatt tcgccaatta attcaagtta atccagaaat tttaatgtat       360
     ttagccggtc aattagctca tcgtttacaa aatacttcaa agcaggtaag caatttggca       420
     tttttagatg tgacaggtcg tatcgctcaa accttgttaa atttagctaa gatgcctgat       480
     gcaatgactc atccggacgg tatgcaaatt aaaattactc gtcaggaaat aggacaaatg       540
     gtaggttgct cacgagaaac tgttgggcgt attttgaaaa tgttagaaga tcagcattta       600
     atttcagcac atggcaaaac tattgttgtg tatggtacaa gataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page