(data stored in ACNUC7421 zone)

EMBL: CP000947.PE40

CP000947.PE40        Location/Qualifiers
FT   CDS_pept        complement(30884..32146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0040"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein; KEGG:
FT                   msu:MS1837 transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32041"
FT                   /db_xref="GOA:B0UUZ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ8"
FT                   /protein_id="ACA32041.1"
FT                   /translation="MHLTELKNKPVSELVELGEKQMGLENLARLRKQDIIFAILKQHAK
FT                   SGEDIFGGGILEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKVDRVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGATEDLTARIL
FT                   DLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSIIHNYPECELIVLLIDERPEEVTEMQR
FT                   SVKGEVIASTFDEPAARHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPP
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAEKRVFPAIDFNRSGTRKEDLLTTPDELQKMWILRKILNPMGEIEAMEF
FT                   LIDKLMMAKTNEEFFEVMKRS"
     atgcatttaa cagaacttaa aaataaacct gtttctgaac ttgtagaatt aggtgaaaaa        60
     caaatgggct tagaaaattt agctcgttta cgcaaacaag acattatttt tgcaatttta       120
     aaacaacatg cgaaaagtgg agaggacatt tttggaggag gtatattaga aattttacct       180
     gatggtttcg gtttcttacg ttctgccgat agttcttact tagccggtcc tgatgacata       240
     tatgtttctc caagtcagat tcgtcgtttc aacctgcaaa cgggcgacaa aattgaagga       300
     aaaattcgtc caccaaaaga aggagagcgt tactttgcct tactaaaagt tgatcgagtc       360
     aatgacgata aaccagaagt atcacgtagt aaaattctct ttgaaaactt aactccacta       420
     cacgcaaatt cacgcctcag aatggagcgt ggaaatggtg caacggaaga tttgactgct       480
     cgtattttag atttagcctc ccctatcggt aaaggacaac gtggtttaat tgtcgctccg       540
     ccaaaagcag gtaaaaccat gttattacaa aatattgcac aaagtattat tcataactat       600
     ccggaatgtg aattaattgt attgttgatt gatgaacgtc cggaagaagt aacagaaatg       660
     caacgctcag taaaaggcga agtcattgct tcaacctttg atgaaccggc agcacgccat       720
     gttcaagttg cagaaatggt gattgaaaaa gcaaaacgtt ccgttgaaca taaaaaagat       780
     gtggttattt tattagatag cataactcgc ttagctcgtg cttataatac ggtaacaccg       840
     ccttccggaa aaatcttatc agggggtgta gatgccaatg cattgcatcg cccaaaacgc       900
     ttctttggtg cagcccgtaa tgttgaagaa ggcggtagtt taaccattat tgccaccgca       960
     cttgtggata ccggctcaaa aatggacgaa gtgatttttg aagaatttaa aggaactggg      1020
     aatatggagt tgcatctttc ccgtaaaatc gcagaaaaac gtgtatttcc tgctattgac      1080
     ttcaatcgtt ctggtacaag gaaagaagat cttctgacta caccagatga attacaaaaa      1140
     atgtggattc tacgtaaaat tcttaatcca atgggtgaaa ttgaggcaat ggaattctta      1200
     attgataagc taatgatggc aaaaaccaat gaagaatttt ttgaagttat gaaacgttct      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page