(data stored in ACNUC7421 zone)

EMBL: CP000947.PE41

CP000947.PE41        Location/Qualifiers
FT   CDS_pept        32341..33600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0041"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   hso:HS_0174 ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32052"
FT                   /db_xref="GOA:B0UUZ9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ9"
FT                   /protein_id="ACA32052.1"
FT                   /translation="MQNSHLSQQRFSDLALHRIVQQAIKEKGFEFCTPIQALSLPITLK
FT                   GQDIAGQAQTGTGKTIAFLTATFHHLLQKNNINSSEQPRALILAPTRELVVQIANDANF
FT                   LVQATGLKTGLAYGGEGYDKQLKVIDRGIDILIGTTGRVIDYVKQGIIRLDYIQVVVLD
FT                   EADRMFDLGFIRDIRYLLRKCPVPQQRLTMLFSATLSYKVRELAFEHMNDPQYVEIEPL
FT                   QKTGHRIREELFYPSNQDKMALLMTLLEEEWPERCIIFSNTKHRCEEIWGYLSADGHRV
FT                   GLLTGDVMQKKRLSLLKQFTDGTLDVLVATDVAARGLHIPDVTHVFNYDLPDDCEDYVH
FT                   RIGRTGRAGESGISISFACEEYAINLPAIEEYIGHSIPVSQYDAKALIEDLPTPHRIKR
FT                   GAFDSRSNLQRTVKRLKKTY"
     atgcaaaata gtcatctttc acaacaacgt ttttctgatc ttgctttaca tcgtatcgtg        60
     caacaagcga taaaagaaaa aggctttgag ttttgtacac ctattcaggc attgtcttta       120
     cctatcacct taaaagggca agacatagct gggcaggctc aaaccggcac aggaaaaacg       180
     atcgcatttt taaccgctac atttcatcat ttactacaaa aaaacaatat aaattcctca       240
     gaacaaccga gagcgttaat tttggcaccg actagagaat tggttgtaca aattgcaaat       300
     gatgcgaatt ttctagttca agcaacaggg ttgaaaacag gcttagctta tggtggtgag       360
     ggctatgata aacaattaaa ggtaattgat cggggtattg atattttaat tggtactaca       420
     gggcgtgtaa ttgattatgt taagcaagga attattcgtt tagattatat tcaagtggta       480
     gtgttagatg aagcagatcg aatgtttgat ttaggtttta ttagagatat tcgttattta       540
     ttacgtaaat gtccggtgcc tcaacaacgt ttaaccatgc ttttttctgc aactttgtct       600
     tataaggttc gtgaacttgc ttttgagcat atgaatgatc cacagtatgt agaaattgaa       660
     cccttacaaa aaacggggca tagaattaga gaggagttat tttacccttc taatcaagat       720
     aaaatggcat tgttgatgac tttattagaa gaagaatggc cagagcgttg cattattttt       780
     tctaatacta aacatcgttg tgaggaaata tggggatatt taagtgcgga tggtcatcga       840
     gtaggattat tgactggtga tgtaatgcag aaaaaacgct tatctttact caaacaattt       900
     acggatggaa ccttagatgt tttggtggcg acagatgtgg cagcacgagg gttacatatt       960
     ccggatgtga ctcatgtgtt taattatgat ttacctgatg attgtgagga ttatgtacat      1020
     cgtattggaa gaacagggcg agcgggtgaa agcggtattt caatcagttt tgcttgtgaa      1080
     gaatatgcga ttaatctgcc tgcaattgaa gaatatattg gtcacagtat tcctgtcagt      1140
     caatatgatg cgaaagcatt gatcgaagat ttgccaacac ctcatcggat taaacgaggt      1200
     gcatttgata gccgttcaaa tttacaacgt actgtaaaga gattgaaaaa aacttattaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page