(data stored in ACNUC7421 zone)

EMBL: CP000947.PE43

CP000947.PE43        Location/Qualifiers
FT   CDS_pept        34397..35071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0043"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase ;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0176 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32074"
FT                   /db_xref="GOA:B0UV01"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV01"
FT                   /protein_id="ACA32074.1"
FT                   /translation="MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMT
FT                   WIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETL
FT                   EALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGK
FT                   FGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI
FT                   TQ"
     atgacacaat ttaaattaat tggttttgat ttagatggta ccttagtaaa cagtttgcct        60
     gatttagctt tatcaattaa ctctgctttg aaagacgtta atttgccaca agcatcggaa       120
     aacttggtga tgacttggat tggcaatggt gctgatgttt tgagtcaacg tgcagtggat       180
     tgggcttgta cacaagctga aaaagagtta acggaagatg agtttaaata ttttaaacgt       240
     caatttggct tttattatgg cgaaaatctt tgtaatatca gtcgattata tccaaatgtg       300
     aaagaaacct tagaagcatt aaaagcacaa ggctacattt tagcagtcgt gacgaataaa       360
     ccaactaaac atgttcagcc tattttaact gcttttggga tcgatcattt gtttagtgaa       420
     atgctggggg gacaatcttt accggaaatt aagcctcatc cggcaccttt ctattattta       480
     tgtggcaagt ttggtctgta tccgaaacaa attctttttg ttggcgattc gcaaaatgat       540
     atttttgctg ctcattctgc gggttgtgct gtggttgggt taacttatgg ttataactat       600
     aatattccaa ttgcacaatc aaaacctgat tggatctttg atgattttgc tgatatttta       660
     aaaattacac aataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page