(data stored in ACNUC7421 zone)

EMBL: CP000947.PE45

CP000947.PE45        Location/Qualifiers
FT   CDS_pept        complement(36303..36686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32093"
FT                   /db_xref="GOA:B0UV03"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV03"
FT                   /protein_id="ACA32093.1"
FT                   /translation="MKFMLIQQRLIFLVQRHLIDEDIMTITLNIRNRLGKKWRVNLKTK
FT                   QVDMLLIHLAMALGRIKRGYVAKALNPDFFSEIERAVCFTKILKLHQELLTFIPFPVPK
FT                   EEQSHFIANIYSLSLAQPWILTP"
     atgaaattca tgttaataca gcaaaggctg atttttttag ttcaacgcca tttaattgat        60
     gaagatatta tgacaattac tcttaatatc cgaaatcgtc ttggtaaaaa atggcgagta       120
     aatttaaaaa cgaaacaagt agacatgtta ctcattcatt tagctatggc actaggcaga       180
     ataaaaagag gatatgtggc taaagcatta aacccagatt ttttttcaga gatcgaaaga       240
     gcggtctgtt ttacaaaaat tttgaaatta caccaagaac tattaacctt tattcccttc       300
     cccgttccca aagaagaaca atctcatttc atcgctaata tttattctct ttcattagca       360
     caaccttgga ttttaacacc ctaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page