(data stored in ACNUC7421 zone)

EMBL: CP000947.PE46

CP000947.PE46        Location/Qualifiers
FT   CDS_pept        36796..37398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0046"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0179 possible phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32104"
FT                   /db_xref="GOA:B0UV04"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV04"
FT                   /protein_id="ACA32104.1"
FT                   /translation="MLNKEIIARYEGLIFDMDGTVIDTMPCHKQAWELVGAEMGYALDG
FT                   DVMYQLGGAPVRTIAKAIMEKAQMPLYLMEDVISLKRKYGIELIMKNATLLPAADIVKQ
FT                   YVGQKPLALGTGSHRYVTEMLLEKFQLQSYFGAIVTAEDVINHKPEPDTFLRCAELLNL
FT                   DPLKCLVFEDADLGVQAGLAAEMDVFDVRVNQIITSK"
     atgttaaaca aggaaattat cgcacgatat gaaggattaa tttttgatat ggatggcaca        60
     gtaattgata ctatgccttg tcataaacaa gcttgggagc ttgttggtgc tgaaatgggc       120
     tatgctttgg atggagatgt tatgtatcaa ttggggggag ctccggtaag aactattgcc       180
     aaagccataa tggaaaaagc acaaatgccg ttatatttaa tggaagatgt gattagttta       240
     aagcgtaaat atggaattga attaatcatg aaaaatgcta ctttattgcc tgctgcggat       300
     attgtgaaac aatatgttgg acaaaagcct ttagctctcg gtacaggttc acatcgttac       360
     gtcacggaaa tgcttttaga gaaatttcaa ttgcagtctt attttggtgc tattgtgaca       420
     gcggaagacg tgattaatca caaacctgag ccggatacat ttttgcgttg tgcagaatta       480
     ttaaatcttg atccgttaaa atgccttgta tttgaagatg cggatttggg cgtacaagcc       540
     ggattagcgg cggaaatgga tgtttttgac gttcgtgtaa atcaaataat tacaagcaag       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page