(data stored in ACNUC7421 zone)

EMBL: CP000947.PE47

CP000947.PE47        Location/Qualifiers
FT   CDS_pept        complement(37776..40529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0047"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: hso:HS_0181 TonB-dependent outer
FT                   membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32115"
FT                   /db_xref="GOA:B0UV05"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV05"
FT                   /protein_id="ACA32115.1"
FT                   /translation="MMTNKFKLTAVAFSVLSTCVYAEEMLDQINVEYKLPPKQEVFKKA
FT                   GATSVRENISTSTQSIDDIIRTVPGAFTNLDKSSGTVSVNVRGQTGFGRVNTMVDGISQ
FT                   TFFATSGDNSEKAGGTSQFGATIDPAFITSVDIQRGSFDGKAGANALVGSANFRTIGVD
FT                   DVISEGRNVGALLNVGGGTNATGPNYMGAVAFRYPFSDTRTLGFMYAYSWRKSSQDFKV
FT                   GGGRSIKDVDAEEVGRIVEEACKGEAFCDRNEKRKLYGLQPYDPSKLLHYPQSHLAKIE
FT                   YNDKYNKAILSYRSLSTALSGRNLENKNYQLNYQLKPKENLQFELILADNTSTQTYHKG
FT                   SVFNGKMLKDVLESKNSAKTTDINMHFSIPFTEKFSYEATLGANILKNKYSKNRHPREL
FT                   GYYFDGGEPNSLDACDEVGKYKNACKYHGIRSNTFQPDGEQRFKTLYFDQTFKYDIYTL
FT                   KVNANRQIYKYEGRIFPLDPKDRFSSRTWHDSHKKMKNGKPIWVNSNSSEIVAKYGVEE
FT                   AEKLGCYTGPNDDDTTWDVYNCPSFYSVHKGDSRSHDNYSMSFSADFHPLFSPFVSYAK
FT                   THRVPNIKEMYFSEFGTLAIRPDLKSEKAKTIQFGINGYKNGIFSDFDALGFKILAYQT
FT                   KIRDYIINIKQECSSNAWRGSNKAPTIYDCVEHLTHINYEGGKTILKTDLVDTGDGKTK
FT                   VPSNQLIPADSSPIVKIQGLELELNYDIGWFYANLSYARQKTNQPSSFSDSSYNVSDDS
FT                   ETGQYLQGFGLSKISSLPKDYGSLDLGTRLFDGKLTLGGTAKYYGKSKRARLDKADGDV
FT                   ILPGTFTSRKTGETFLTYVRISGTEEIKAQPIIFDFYAIYQPTENLTIKGEIQNAFDKK
FT                   YINPLDANNDSANQMTYAMGVGDGYQKALNNYSKGRTFVLNVNYKF"
     atgatgacta ataaatttaa actcactgcg gtagcttttt ccgtattaag cacttgtgtt        60
     tatgcagaag aaatgctcga tcaaattaac gtagaatata agctaccacc taaacaggaa       120
     gtctttaaaa aagcgggggc gaccagtgtg agagaaaata tttccacgtc aacgcagtct       180
     attgatgaca tcatcagaac ggtaccgggt gcgtttacca accttgataa aagttcgggg       240
     acagtgtcgg tgaacgttcg tggtcaaacg ggatttggac gggtgaatac gatggtggac       300
     ggtatttccc aaaccttttt tgccacatca ggagataaca gcgaaaaagc cggtggaacc       360
     tctcaattcg gtgcaaccat tgaccctgcg tttattacca gtgtagatat tcaacgagga       420
     agttttgacg gtaaagcggg ggctaatgct ctagtaggtt cggcaaattt tagaacaatc       480
     ggtgttgatg acgtaataag tgaaggcaga aatgtaggtg ctttattaaa tgttggcgga       540
     ggaaccaatg caaccggacc gaattatatg ggtgcagttg cctttcgcta tcctttttcc       600
     gatacaagaa cattaggttt tatgtatgcc tatagttggc gtaaaagctc gcaagatttt       660
     aaagtggggg ggggtagaag tataaaagat gttgacgctg aagaagtggg aagaatagtt       720
     gaagaagcct gtaaaggcga agcattttgt gacagaaatg aaaaacgaaa actctatgga       780
     ttacaaccct atgacccaag caaattactc cactatcccc aaagccattt agccaaaatc       840
     gaatataacg ataaatataa taaagctatc ctatcatacc gctctttatc gaccgcactt       900
     tccggcagaa atttagagaa taaaaactac cagttaaact accaactaaa accgaaagag       960
     aatttacaat ttgaattaat cttggcggat aatacctcta cgcaaaccta tcacaaggga      1020
     agcgtgttta atggtaaaat gctgaaagat gtgttggaaa gcaaaaatag tgcgaaaacc      1080
     acggatataa atatgcattt ttctattcca ttcacagaaa aattctctta tgaagcaaca      1140
     ttaggtgcca atatcctcaa aaataaatac agtaaaaatc gacatcctcg tgaattaggt      1200
     tattattttg atggtgggga acctaattca cttgatgctt gtgatgaggt tggtaagtat      1260
     aaaaacgcat gtaaatatca cggcataaga tcgaatacat tccaacccga cggcgaacaa      1320
     cgttttaaaa ccctctattt tgaccaaacc tttaaatacg atatttatac cttaaaagtc      1380
     aatgccaatc gccaaatcta taaatacgaa ggtaggattt tccctcttga tcctaaagat      1440
     agattttcat ctagaacatg gcatgactct cataaaaaaa tgaagaatgg aaagccaatt      1500
     tgggtcaatt ccaactcatc agagatagtt gcgaagtatg gtgttgagga agcagaaaaa      1560
     ttggggtgtt atactggtcc taatgatgat gataccactt gggatgttta taactgccca      1620
     agtttttact ctgtccacaa gggagattca agatctcatg ataattattc tatgtctttc      1680
     tcggcggatt ttcacccgct cttttcgcca tttgtgagtt atgccaaaac ccatcgggtc      1740
     ccgaatatca aagagatgta tttctccgaa tttggtacat tagccataag acccgattta      1800
     aaatcagaaa aagccaaaac cattcaattc ggcattaacg gttataaaaa tgggatattc      1860
     tcggattttg atgcactagg ctttaagatt ttagcgtatc aaacgaaaat cagagattat      1920
     attatcaata tcaaacaaga atgtagttca aacgcgtgga gaggatcaaa caaagcaccg      1980
     actatttatg actgcgttga acatcttacg catattaact atgaaggcgg taaaacaatc      2040
     ttgaaaacag acttggtgga tacaggagat ggaaaaacaa aagttccttc aaaccaactc      2100
     attcctgctg attcatcacc tattgttaaa attcaggggt tggaacttga attaaattat      2160
     gatatcggtt ggttctatgc caacttatct tatgccagac aaaaaaccaa tcaaccaagt      2220
     tcattttctg attcaagtta taatgtgagt gatgatagtg aaaccggaca atatttacaa      2280
     gggttcggct taagtaaaat atcgtctcta ccgaaagatt acggttccct tgacctagga      2340
     acacgtttat ttgacggaaa attaacatta ggcggtactg ctaaatacta tggtaaaagc      2400
     aaacgagcca gacttgataa agcagatggc gatgttatct tgccgggaac ttttacttct      2460
     agaaagactg gcgagacatt tcttacttat gtaagaatta gcggcacgga agaaatcaaa      2520
     gcacagccaa taattttcga tttttacgct atctaccaac caacggaaaa cttaactatt      2580
     aaaggcgaaa ttcaaaacgc ctttgataaa aaatacatta atccgctaga tgcgaataac      2640
     gactcggcaa accaaatgac ttatgctatg ggcgtgggcg atggatacca gaaagcctta      2700
     aacaactatt caaaaggacg cacatttgtt ttaaatgtaa attataaatt ctaa            2754
//

If you have problems or comments...

PBIL Back to PBIL home page