(data stored in ACNUC7421 zone)

EMBL: CP000947.PE48

CP000947.PE48        Location/Qualifiers
FT   CDS_pept        complement(40762..41379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0048"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   hso:HS_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32126"
FT                   /db_xref="GOA:B0UV06"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV06"
FT                   /protein_id="ACA32126.1"
FT                   /translation="MLSVFNFIDLLGTFIFALSGAVAGVKKQFDLFGVFVVSAVTAIGG
FT                   GIIRDLCLSATPPAGLENIAYLLIILLAVCCVSFFQEKITSFSKVSNLLDAVGLGFFAA
FT                   FGANKTWYMTENIQLSIILGCISAVGGGCIRDVLTNKSPLIFQSEIYAGAAIVGATIEL
FT                   LGSTGLISPLLSPWLAIITCTLIRMLAIKYRIQFPFIKDKSL"
     atgttatccg tatttaattt cattgatctt ctcggtacat ttatctttgc cttaagtggt        60
     gcggttgctg gcgtgaagaa acaatttgat ttatttggtg tttttgttgt ctcagcagta       120
     acagcgatag gcggtggaat tattcgagat ttatgcctat cagcaacacc gccggcaggc       180
     ttggaaaata tcgcctatct attaattatc cttttagccg tgtgttgcgt atcttttttt       240
     caagaaaaaa taacgtcgtt ctcaaaggtg agcaacttac ttgatgccgt tggattaggt       300
     ttttttgcag cgttcggggc gaataaaacg tggtatatga cggaaaatat ccaattatct       360
     attattttgg gttgtattag tgcggtgggt ggtggctgta tccgagatgt attgacaaac       420
     aaatcgccgt taatttttca atctgaaata tatgcaggtg cagccattgt cggtgcaacc       480
     atagaactat taggttcgac aggcttaatt tctcccctac taagtccatg gctggcaatt       540
     ataacctgta cactcatcag aatgctggcg ataaaatatc gcattcagtt tccttttatt       600
     aaagataaat ctttgtaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page