(data stored in ACNUC7421 zone)

EMBL: CP000947.PE49

CP000947.PE49        Location/Qualifiers
FT   CDS_pept        41621..43156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0049"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: hso:HS_0183 threonine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32137"
FT                   /db_xref="GOA:B0UV07"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV07"
FT                   /protein_id="ACA32137.1"
FT                   /translation="MISNLTEQPSGAEYLKAILSSKIYELAQVTPLQPMLKLSERLSNT
FT                   VLVKREDRQLVHSFKLRGAYAMIAGLSQPQKNAGVITASAGNHAQGVALSAKNLGLNAL
FT                   IVMPQNTPRIKVDAVRGYGGEVLLYGANFDEAKAKAIELSESKSMTFIPPFDHPAVIAG
FT                   QGSLAMELLQQNSHIDRIFVPVGGGGLAAGVAVLIKQLMPDIKVIAVESKDSACLHAAL
FT                   KVGQPVDLERVGLFADGVAVKRIGNETFRVCQQYIDDVVLVDSDEVCAAMKDMFENVRA
FT                   IAEPSGAVSLAGLKKYVKEHNIQGETLVNILSGANLNFHTLRYVSERCEIGEKHEAIFA
FT                   VTIPEEKGSFLRFCHLLGDRPVTEFNYRYADKEQACIFVGVRISSEKEKLEIIQQLEQN
FT                   DYKVMDLSDDEIAKTHIRYMIGGRTTSNSKERLYSFEFPEQKGALLKFLMMLGTHWNIS
FT                   LFHYRAYGADYGNVLAGFQLDEHDEIRFNGHLEELAYTYQDVTDSPAYKYFLA"
     atgataagta atttaaccga acagccttct ggtgctgagt accttaaagc aattttaagt        60
     tcaaaaattt acgaacttgc acaggttaca cccttacaac ctatgctcaa actttctgag       120
     cgtttaagta ataccgtttt agttaaacgt gaagatcgcc aattagttca tagctttaaa       180
     ttgcgtggtg cttatgccat gattgccggt cttagccaac cgcaaaaaaa tgccggtgtg       240
     attaccgctt ccgcaggaaa tcatgctcaa ggtgtcgcac tgtcagcgaa aaatctggga       300
     ttaaacgcat tgattgttat gccgcaaaat accccccgca ttaaagtaga tgcagtgcgt       360
     ggttatggtg gcgaagtgct tttatatggt gcaaactttg atgaggcaaa agcaaaagcg       420
     atagagcttt ctgaaagtaa aagtatgaca tttattccgc cttttgatca cccggcagtt       480
     attgcaggtc aaggttcttt agccatggaa ttattgcagc aaaacagtca tattgatcgt       540
     atttttgttc ctgttggcgg cggcggatta gcagctggcg tggctgtttt aattaaacaa       600
     ttaatgcctg acattaaagt gattgcggta gaaagtaaag attcagcttg tttacacgcc       660
     gctttgaaag ttggtcaacc ggtagattta gagcgtgtcg ggttgtttgc tgacggtgtg       720
     gcggtaaaac gtatcggtaa tgaaactttc cgtgtatgtc aacaatatat tgatgatgtt       780
     gtacttgttg acagcgatga agtgtgtgcg gcaatgaaag atatgtttga aaatgtgcgt       840
     gctattgcag agccatccgg tgccgtatca ttagccggct taaaaaaata tgtgaaagaa       900
     cataatattc aaggtgaaac gttggttaat attttgtccg gtgcaaattt aaattttcat       960
     acattgcgtt atgtgtcaga acgctgtgaa atcggtgaaa aacacgaagc aatttttgct      1020
     gtaactatcc ctgaagaaaa aggtagtttc ctacgttttt gccatctgtt aggtgatcgt      1080
     cctgttaccg aatttaacta tcgttatgct gataaagaac aagcctgtat ttttgttggg      1140
     gttcgtatta gtagtgaaaa agaaaaatta gaaattattc aacaacttga acaaaatgat      1200
     tataaagtta tggatctctc tgatgatgaa atagcgaaaa cccatattcg ctatatgatt      1260
     ggaggacgaa caaccagcaa tagcaaagag cggttatata gcttcgagtt tcccgagcaa      1320
     aaaggcgcat tattaaaatt cttgatgatg ttaggtacgc attggaatat ttctcttttc      1380
     cattatcgtg cttatggtgc agactatggt aacgttttgg caggctttca gttagatgaa      1440
     catgatgaaa ttcggttcaa tggtcattta gaagaacttg cttatactta tcaagatgta      1500
     acggacagcc ccgcttacaa atatttctta gcttga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page