(data stored in ACNUC7421 zone)

EMBL: CP000947.PE50

CP000947.PE50        Location/Qualifiers
FT   CDS_pept        complement(43200..44144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0050"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="TIGRFAM: hydroxymethylbutenyl pyrophosphate
FT                   reductase; PFAM: LytB protein; KEGG: hso:HS_0184
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32147"
FT                   /db_xref="GOA:B0UV08"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV08"
FT                   /protein_id="ACA32147.1"
FT                   /translation="MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHEVVHNRFV
FT                   VNGLRERGAIFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHM
FT                   QVARASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITF
FT                   MTQTTLSIDDTAGVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAKLSDLVIVVGS
FT                   KNSSNSNRLAELASRMGVTAKLIDDANDIEVSWLDNVTVIGLTAGASAPEILVQSVISR
FT                   LKELGVDKVEELEGCEENTVFEVPKELRIKEVE"
     atgaaaatta ttttggctaa tcccagaggc ttttgtgccg gtgttgatcg agctattagt        60
     atcgtggagc ttgcattaga aattcacggt gcacctattt atgtgcgtca tgaggttgta       120
     cataatcgtt ttgttgtgaa tggattgcgt gagcgtgggg caatttttgt ggaagaatta       180
     gatgaagtac ctaatggtgc tattgtaatt ttttctgcac acggtgtttc gcaagctgtt       240
     cgtcaagagg ctaaagagcg gaatttaaaa gtatttgatg ccacttgtcc tttggttaca       300
     aaagtgcata tgcaggttgc tcgtgccagt cgtaaaggaa caaaagccat tctcattggg       360
     catgaaggac accccgaagt gattggcaca atgggacaat atgataacga taagggcggt       420
     atttatttag tagaagatgt ggaagatatt gccaaactga ctttacggaa tgatgaagac       480
     atcacgttta tgacacaaac cacattatca attgatgata ctgccggtgt aattgaggtg       540
     ctaaaacaaa aatatcccgc cattcaaggt cctcgcaaaa atgatatttg ctatgcaaca       600
     accaatcgac aacaagcagt tcgtgaatta gccaaactgt ccgatttagt tattgtggta       660
     ggttctaaaa actcatctaa ttccaatcga ctggctgaac ttgcctcaag aatgggtgtt       720
     acggcgaaat taattgatga tgcaaatgat attgaggtaa gttggttgga taatgttaca       780
     gttattggtt taacagctgg tgcttcagct ccggaaatat tggttcaatc ggtgatttcc       840
     cgtttaaaag aattaggtgt tgataaagtg gaagaacttg aaggttgcga agaaaatacc       900
     gtttttgaag tgccgaaaga gttgcgaatt aaagaagttg agtag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page