(data stored in ACNUC7421 zone)

EMBL: CP000947.PE52

CP000947.PE52        Location/Qualifiers
FT   CDS_pept        45025..45258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0052"
FT                   /product="outer membrane protein P1"
FT                   /note="KEGG: hso:HS_1548 outer membrane protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32169"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV10"
FT                   /protein_id="ACA32169.1"
FT                   /translation="MKKKITFTKSLIASALALSASYVNASAFQLAEVSSSGLGRAYAGE
FT                   AAIADNAAVVATNPALMSLFKAKQFSWGGGIR"
     atgaagaaaa aaatcacttt tactaaatct ctcatcgctt cagcgttggc attatcagcg        60
     agttatgtca atgcgtctgc tttccaactc gccgaggtat ccagttccgg tttggggcgt       120
     gcttatgcag gtgaagcggc aattgctgat aatgccgccg ttgtagcaac caaccctgca       180
     ttaatgagtt tgtttaaagc gaaacaattc tcatgggggg ggggtatacg ttga             234
//

If you have problems or comments...

PBIL Back to PBIL home page