(data stored in ACNUC7421 zone)

EMBL: CP000947.PE53

CP000947.PE53        Location/Qualifiers
FT   CDS_pept        45428..46420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0053"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: hso:HS_1548 outer membrane
FT                   protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32180"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV11"
FT                   /protein_id="ACA32180.1"
FT                   /translation="MNMNFSLRSKYKDDYVGGVLGGTSEMDSINLNLSGSYRVSKGLSV
FT                   GAGLNAIYAKAKFERRAGILKKTIDSLRSDDNELLILLSPSIVSSAYSLTFHENSTVAR
FT                   LQDNNAWGLGWNIGAVYEFNQDNRIGIAYHSKVDIDFKDNDTLGYILGKEEIKLHRAKG
FT                   KLTLHLPSYFEISGFHQLTAKFAMHYSYKYTQWSRLQSLHAAYSNGEVAFHKDENFHDS
FT                   SRVALGATYDVNDKLTLRAGIAYDESADHPTASIPDTDRTWYSLGATYHFTPNLSVDMG
FT                   FAHLRGKKQKFKENHSFTSKDNYEVGRIDADYQSTARANLYGLNLNYRF"
     atgaatatga actttagttt gagaagtaaa tataaagatg attatgttgg cggtgttttg        60
     ggtggaacaa gcgagatgga ttctattaat ttgaatttaa gcggttcata tcgtgtcagc       120
     aaaggattaa gcgttggtgc aggattaaat gccatttatg ccaaagcgaa atttgaacgc       180
     cgtgcaggga ttttaaagaa aactattgat agtttacgta gtgatgacaa tgagctgctt       240
     attttactct ctccatcaat agtatcatcg gcatatagcc taacatttca tgaaaacagt       300
     actgtagcac gcttacaaga taacaatgca tggggattgg gttggaatat cggtgcggtt       360
     tatgaattta atcaagataa tcgtatcggt attgcctacc attctaaagt agatattgat       420
     tttaaagata atgatacatt gggttatata cttggcaaag aagagattaa gcttcatcgt       480
     gcaaaaggta agttaacttt acatttaccg agctatttcg aaatttccgg tttccaccaa       540
     ttaacagcaa aatttgctat gcactacagc tataaatata cgcaatggag ccgtttacaa       600
     agtttgcatg ccgcttattc caatggtgaa gtcgcttttc ataaagatga aaactttcat       660
     gacagttctc gtgtagcttt aggggcaact tatgatgtga atgataaatt aactttacgt       720
     gcaggtattg cttatgatga atccgccgac cacccaactg cttccattcc ggataccgac       780
     cgcacttggt acagcttagg ggcaacctat catttcacac caaatctttc tgtcgacatg       840
     ggctttgctc atttacgcgg taaaaaacag aaatttaaag agaaccactc atttacaagc       900
     aaagataatt atgaagtagg tagaatagat gcagattatc aatcaacagc acgagccaat       960
     ctgtatggct taaatcttaa ctaccgtttc taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page