(data stored in ACNUC7421 zone)

EMBL: CP000947.PE55

CP000947.PE55        Location/Qualifiers
FT   CDS_pept        complement(49399..49947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32200"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV13"
FT                   /protein_id="ACA32200.1"
FT                   /translation="MKKLKNLLLILGTFIPCLSFAQNIILDGYKDLKFGMTYQQIADSK
FT                   LCTGWEYYQPLNSYKCQHFLFNGNNREATAYFNGQVLNSIAIDILNYNQNRPPFPREVQ
FT                   EVKDILNGLPQKYGPPTKVVCGADYARSNEECNINTTDINFEDYWMVEFLNGQIRLVNS
FT                   VNQWVILVYSSAKTILDSL"
     atgaaaaagt taaaaaattt gttgctgatt ttgggtacat ttattccctg cttgagtttt        60
     gcccaaaata tcattttaga cggttataaa gatcttaaat tcggcatgac ctatcaacaa       120
     attgccgact ctaaattatg caccggttgg gaatattacc agccattaaa ttcttataaa       180
     tgtcagcatt ttttatttaa cggcaataat cgagaagcaa ccgcttattt taatggacaa       240
     gtattgaaca gtattgcaat tgatattttg aattataacc aaaacagacc gcccttccca       300
     cgtgaagtac aagaagtgaa agatatttta aatggattgc cccaaaagta tggtccgccg       360
     acaaaagtag tatgcggtgc agattatgct cggtcaaatg aagaatgcaa tattaatact       420
     acagatatta attttgagga ttattggatg gttgaatttc tgaatggaca aattcgttta       480
     gtaaattcgg taaatcaatg ggttatcctt gtgtattcca gtgcgaaaac aatcttggat       540
     tcattataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page