(data stored in ACNUC7421 zone)

EMBL: CP000947.PE56

CP000947.PE56        Location/Qualifiers
FT   CDS_pept        complement(50045..50989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0056"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain; PFAM: Riboflavin kinase
FT                   / FAD synthetase; KEGG: hso:HS_0188 bifunctional riboflavin
FT                   biosynthesis protein/riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32211"
FT                   /db_xref="GOA:B0UV14"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV14"
FT                   /protein_id="ACA32211.1"
FT                   /translation="MQLIRGFHNLPEPLKQQGCAVTIGNFDGVHLGHQSILQHLKAKAK
FT                   QLNLPVVVMLFEPQPYEYFQGDQAPARLMRLRDKLAYLAQLGVDYVFCVKFNRTFAQLS
FT                   AEQFISDCLVKHLKMKFLSIGDDFRFGLNREGDFRLLQKKGQQQSFIVEDNRSLQLNDQ
FT                   RISSTAIRQALSEDNLALAEKLLGKPYRIYGRVAHGNKLGRTIGFPTANIYLHRQVNPI
FT                   KGVYVVKVRLKNGDIFQGVANIGKRPTINGVKQLLEVHLFNFDRDLYGQSLQIEFCHKI
FT                   RHEKKFPSLNALKNQIENDVVVAKKYFQQVLNL"
     atgcaactta ttcgtggttt tcataattta cccgagcctt taaaacagca gggttgtgct        60
     gtaactattg gtaattttga tggtgttcat ttagggcatc aatccatttt gcaacattta       120
     aaagcgaaag caaaacaact gaatttgccc gttgtagtga tgttatttga acctcaacct       180
     tatgagtatt ttcaaggtga tcaagcaccg gcaaggctta tgcgtttacg agataaactc       240
     gcctatctag cacagttagg tgtagattat gttttctgcg ttaaattcaa ccgcactttt       300
     gcccaattaa gtgcggagca atttatttca gattgtttag tgaaacatct gaagatgaag       360
     tttttaagca ttggtgatga ctttcggttt ggtttaaatc gagaaggcga ctttcgactt       420
     ctgcaaaaaa aagggcaaca acaaagcttt atagtggaag ataatcgaag tttacaatta       480
     aatgaccagc gtattagtag caccgccatt cgccaagcct tatcagaaga taatttagcg       540
     ttggcagaaa agttactggg taagccatat cgtatttatg gacgagttgc tcatggcaat       600
     aaattaggac gaactattgg ttttcccact gcaaacattt atttacatcg gcaagttaat       660
     ccaattaaag gtgtatacgt tgtaaaagtg cggttaaaaa atggcgatat ttttcaagga       720
     gttgccaaca ttggcaagcg acctactatc aatggcgtaa aacaattatt ggaagtgcat       780
     ttgtttaact ttgatcgtga tttgtatggt caatccttgc aaattgaatt ttgccataaa       840
     attcgccatg aaaaaaaatt tccttctcta aatgccctta aaaatcagat tgaaaatgat       900
     gttgttgtgg caaaaaagta ttttcagcaa gtcttgaacc tttga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page