(data stored in ACNUC7421 zone)

EMBL: CP000947.PE58

CP000947.PE58        Location/Qualifiers
FT   CDS_pept        complement(51613..52077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32231"
FT                   /db_xref="GOA:B0UV16"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV16"
FT                   /protein_id="ACA32231.1"
FT                   /translation="MDLILKLLDDMFFAAIPAVGFALVFNVPKNVLKYCAFLGALGHGT
FT                   RTFLVHFDIPLVFATFIAASVVGFIGVYLSHRYLAHPKVFTVAAVIPMIPGVFAYKAMI
FT                   AIVHLHHYGFNEQRVAQMTEYFLKTGFLIGALVFGLALPGLLFYRHKPVV"
     atggacctta tcttaaagtt attagatgat atgttttttg cagctattcc tgctgtcgga        60
     tttgctttag tgtttaatgt acctaagaat gttttaaaat attgtgcatt tttgggggca       120
     ttggggcatg ggacaagaac tttcttagta catttcgata ttcctttagt ttttgcgact       180
     tttatagctg ccagtgtggt tgggtttatt ggcgtatatt tatcgcatcg ttatttggct       240
     cacccgaaag tttttactgt cgcagcggtt attccaatga tcccaggcgt tttcgcttat       300
     aaagccatga tcgcaattgt tcatttgcat cattatggtt tcaatgaaca acgtgtagca       360
     caaatgacgg aatattttct caaaacaggt ttcctcattg gagcacttgt ttttggccta       420
     gcattacccg gcttattgtt ttatcgacac aaacctgtag tatag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page