(data stored in ACNUC7421 zone)

EMBL: CP000947.PE59

CP000947.PE59        Location/Qualifiers
FT   CDS_pept        complement(52080..52868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0059"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   hso:HS_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32242"
FT                   /db_xref="GOA:B0UV17"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV17"
FT                   /protein_id="ACA32242.1"
FT                   /translation="MNTTEDNSSFRQREITRTCAQVAQMLLQHGAESTLIVQMAQRLGF
FT                   ALGIDSVECALTPNAVIITTLYDHNCITTVRKNLDKGINMQVVTEVQRLVIMAEKGLYD
FT                   LQQIRKKLDGIKPLKYNRFVVVTMIGLSCACFAHLSGGDIIVFLITFIASSIAMFIRQT
FT                   LALRHYNPLIVFAITAFVASMVAGLAVKYELGNDPQIALASSVLLLVPGFPLINSLADI
FT                   LKGHINMGIARWTLATVLTFGTCLGIVFALSFLHIANWGR"
     atgaatacta cagaggataa tagctcattt cgacaacgag aaataacaag aacttgtgca        60
     caagttgcac agatgttatt gcagcatggt gcagaaagta cattgattgt acaaatggca       120
     caacgtttag gttttgcatt gggaatagat agtgtggaat gtgcactgac acctaatgcc       180
     gtcattatta ctacattata tgatcacaat tgcattacta cggtacgcaa aaaccttgat       240
     aaaggcatta atatgcaagt ggtaacagag gtacaacgct tggtaattat ggcagaaaaa       300
     ggactatatg atctgcaaca gattcgcaaa aaattagatg gtattaagcc tttaaaatac       360
     aatcgttttg tagttgttac tatgatcgga ttgtcctgtg cttgctttgc ccatttatct       420
     ggtggagata taatcgtttt tttaatcaca tttatcgcct catctatcgc tatgtttatt       480
     cgtcaaactt tagctttgcg tcattataat cctttgattg tttttgctat aaccgctttt       540
     gttgcctcta tggtggcggg tttggctgtt aaatatgaat taggtaatga tccgcaaata       600
     gccttagcat caagtgtatt gttattggta ccggggtttc cattgattaa ttcgcttgcc       660
     gatattctaa aaggacatat taatatggga attgcacgtt ggactttggc aacagtatta       720
     acttttggta cttgtttagg aattgtattt gcactaagtt ttttacatat tgccaattgg       780
     gggcgttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page