(data stored in ACNUC7421 zone)

EMBL: CP000947.PE6

CP000947.PE6         Location/Qualifiers
FT   CDS_pept        complement(4811..5470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0006"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hso:HS_0141
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32253"
FT                   /db_xref="GOA:B0UUM3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM3"
FT                   /protein_id="ACA32253.1"
FT                   /translation="MEQQQLDIGDAEIVVASKQKTQKIEKRTVKERRQQVLTVLTHMLH
FT                   SERGMERMTTARLAQEVGVSEAALYRYFPSKTKMFEALLDNIENTLFSRINHSIKNETN
FT                   TMNRVRDILQTILDFARKNPGLTRILTGHALMFEDSQLQARVARFFDRLELQFVNILQM
FT                   RKLREGKSFHLDEKIIASHLVTLCEGQFMRYVRNNFRHLPNQGFEQQWKLLESLFA"
     atggaacaac agcaattgga tattggcgat gctgaaatcg ttgttgcctc aaaacaaaaa        60
     acgcaaaaaa ttgagaaacg aacagtaaaa gaacgtcgtc aacaggtatt aaccgtacta       120
     acccatatgt tacattcaga acgaggaatg gagcgtatga cgacagctcg cttggcacag       180
     gaagtcggtg tttctgaagc cgcactttac cgttattttc ccagtaaaac caaaatgttt       240
     gaagcattat tggataatat agaaaatact ttatttagtc gaattaatca ctctatcaag       300
     aacgaaacca ataccatgaa tcgtgtgaga gatattttgc aaactattct tgattttgca       360
     cgaaaaaatc cgggattaac ccgaatttta acagggcatg ctttaatgtt tgaagatagt       420
     cagttacaag cacgagttgc acgatttttt gatcgtttag aattacagtt tgtgaatatt       480
     ctacaaatgc gtaaattgag agaaggaaaa tcttttcatc ttgatgaaaa aattattgct       540
     tcccatcttg ttactttatg cgaaggacag tttatgcgtt acgtaagaaa taactttagg       600
     cacttgccta atcaaggttt tgagcaacaa tggaaactgc tggaaagttt atttgcataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page