(data stored in ACNUC7421 zone)

EMBL: CP000947.PE60

CP000947.PE60        Location/Qualifiers
FT   CDS_pept        53026..54138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0060"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: hso:HS_0192 glutamate 5-kinase
FT                   (gamma-glutamyl kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32254"
FT                   /db_xref="GOA:B0UV18"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV18"
FT                   /protein_id="ACA32254.1"
FT                   /translation="METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAG
FT                   FRIIIVTSGAMAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQI
FT                   LLTRADIEDRERFMNARDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILA
FT                   QAEQLYLLTDQRGLFDSDPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKIS
FT                   AADIATRSGVETIIAPGNLENVIVNLAYGKDIGTKFVVQTDRLESRKQWIFAAPVAGIV
FT                   TIDEGAESAVLIQHKSLLPAGIISVEGCFSRGEVVKICGSNGKKIALGVPRYNSDSLIQ
FT                   IKGKKSQDIEQILGYEYGSVAIHRDDMVVY"
     atggaaacac aaaaaacaaa taaaaccatt gtggtaaaat ttggtaccag caccttaacg        60
     caaggttcat caaaattaaa tcgccctcac atgatggaaa ttgtgcgtca aatcacacag       120
     ttgcatcgag caggctttcg tataattatt gttacctccg gagcgatggc agcggggcga       180
     cattatctca atcatccgca acttcctcca acaattgcct caaagcaatt actagcagca       240
     gtaggacaaa gtcaactcat tcaaacgtgg gaacaacttt tcgctattta tgatattcat       300
     attgggcaaa ttctgttaac tcgagcggac attgaagatc gtgaacgttt tatgaacgca       360
     agagatacgt tacatgcttt attagataac cgaattattc cggtaattaa tgaaaatgat       420
     gcggttgcaa ccgctgaaat taaagtgggg gataatgaca acctttctgc attagtggct       480
     attttggcac aagcagaaca actctacttg ctaacagatc aacgtggatt atttgatagt       540
     gatccaagaa aaaatcctca agcaaaactg atttccatag tcgataaaat tactgatcat       600
     atccgctcta ttgccggagg aagtgggaca acgttaggga cgggaggaat gacaacaaaa       660
     attagtgctg ctgacatagc gactcgttcc ggtgttgaaa ccattattgc accgggtaat       720
     cttgaaaatg tcattgtcaa tttggcttat ggaaaagaca tcggcacaaa atttgttgtg       780
     cagacagatc gcttggaaag ccgtaaacag tggatctttg ctgcaccggt tgcaggtata       840
     gtaactattg atgagggagc ggaaagtgcg gtattgattc agcataaatc tctattacct       900
     gcaggtatta tcagtgttga aggatgtttt tctcgtggtg aagttgttaa aatttgtggt       960
     tcgaacggta aaaaaattgc tttgggcgta cctcgctata acagcgattc tctcatacaa      1020
     ataaaaggaa aaaaatcgca agatattgaa cagatcctcg gttatgaata tggttctgtt      1080
     gctattcatc gtgatgatat ggtcgtttat taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page