(data stored in ACNUC7421 zone)

EMBL: CP000947.PE61

CP000947.PE61        Location/Qualifiers
FT   CDS_pept        complement(54299..54853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0061"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides Ouzounis Woese) domain protein; KEGG: hso:HS_0193
FT                   transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32263"
FT                   /db_xref="GOA:B0UV19"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV19"
FT                   /protein_id="ACA32263.1"
FT                   /translation="MTENTAKKRWYVLQAFSGFEGRVAATLREYIKLHQMEEQFGEVLV
FT                   PTEEVVENVGGKRRKSERKYFPGYVLVQMEMNDYTWQLVRSVPRVMGFIGGTPDKPAPI
FT                   SQKEAERILNRVQETADKPRHRKEFQPGEEIRVTEGPFADFNGTVEEVDYDKGRLKVSV
FT                   LIFGRATPVELEFSQVEKANG"
     atgacagaaa atacagccaa aaaacgctgg tatgtccttc aagcattttc cggttttgaa        60
     ggtcgtgttg ctgcgacatt acgagaatat attaaattac atcaaatgga agaacagttt       120
     ggtgaagtat tagttccaac agaagaagta gttgaaaatg ttggtggtaa acgtcgtaaa       180
     agtgagcgta aatatttccc tggttatgtt ttagttcaaa tggaaatgaa tgactatact       240
     tggcagttag ttcgtagtgt tccacgagtg atgggattta tcggtggaac accagataaa       300
     ccggcaccta tttcacaaaa agaagccgaa cgtattctta atcgtgtaca agaaaccgca       360
     gataaacctc gtcatcgcaa agagtttcaa cccggtgaag aaattcgtgt tactgaaggg       420
     ccgtttgccg atttcaatgg tacggttgaa gaagtggact acgacaaagg gcgtcttaaa       480
     gtttctgttt taatctttgg tcgagcaact ccggttgaac tcgaattcag tcaagttgag       540
     aaagcaaacg gttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page