(data stored in ACNUC7421 zone)

EMBL: CP000947.PE62

CP000947.PE62        Location/Qualifiers
FT   CDS_pept        complement(54855..55262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0062"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: hso:HS_0194 protein
FT                   export protein (preprotein translocase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32274"
FT                   /db_xref="GOA:B0UV20"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV20"
FT                   /protein_id="ACA32274.1"
FT                   /translation="MALEITKNKAAPEIEQKSKGLNGFLWLLVVAIVIVAAVSNIYLVE
FT                   KFSTALRVVGIVVALLIALGIAAITNQGMKARRFFSDSRIELRRITWPTRPEAMQTTLI
FT                   VFAVTVIASLILWGLDSVIVSLITFLTDLRF"
     atggcattag aaattacaaa aaataaagca gctccggaaa ttgagcagaa atcgaaaggt        60
     ctaaatggct ttttatggtt gttagtggtt gctattgtta ttgtggcggc tgtaagtaat       120
     atttacttag tagaaaaatt ttcaacagct cttcgtgttg tgggtattgt tgttgcttta       180
     cttattgctt taggtatcgc cgctattact aatcaaggta tgaaagccag aagatttttt       240
     tccgattctc gtattgagct gagacgaatc acatggccta ctcgccctga ggcaatgcaa       300
     acaacattaa ttgtatttgc tgtgactgta atagcatcat taattttatg gggattggat       360
     tcggttatcg tttcattaat tacattttta acggatttaa ggttctaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page