(data stored in ACNUC7421 zone)

EMBL: CP000947.PE63

CP000947.PE63        Location/Qualifiers
FT   CDS_pept        complement(55438..56622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0063"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: hso:HS_1644
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32285"
FT                   /db_xref="GOA:B0UV21"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV21"
FT                   /protein_id="ACA32285.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
     atgtctaaag aaaaatttga acgtacaaaa ccgcacgtaa acgtgggtac aatcggccac        60
     gttgaccacg gtaaaacaac tttaacagca gcgatcacga ctgtattatc caaacacttt       120
     ggtggtgcgg cacgtgcatt tgaccaaatt gataacgcac cggaagagaa agcacgtggt       180
     atcactatca acacttcaca cgttgaatat gatacagcga cacgtcacta cgcacacgtt       240
     gactgtccgg gacacgctga ctatgtaaaa aatatgatta caggtgcggc acaaatggac       300
     ggagctattt tagtggtagc ggcaacagac ggtccaatgc cacaaactcg tgagcacatc       360
     ttattaggtc gtcaggtagg tgtaccgtac atcatcgtat tcttaaacaa atgcgacatg       420
     gtagatgacg aagaattatt ggaattggtt gagatggaag tacgtgaatt actttctcaa       480
     tacgacttcc cgggcgatga cacaccaatt gtacgtggtt cagcattaca agcattaaat       540
     ggagttgctg agtgggaaga aaaaattctt gaattagcgt ctcacttaga caactatatt       600
     ccggagcctg agcgtgcgat tgaccaaccg ttcttattac cgattgaaga tgttttctca       660
     atttcaggac gtggtacagt agtaaccgga cgtgtagagc gtggtattat ccgtactggt       720
     gaagaagttg aaattgtcgg tattaaagag acaacaaaaa ccacggtaac gggtgtagaa       780
     atgttccgta aattattaga cgaaggtcgt gcgggagaaa acattggagc attattacgt       840
     ggaacaaaac gtgaagaaat tgaacgtggt caagtattag cgaaaccggg ttcaattaca       900
     ccgcacacag actttgaatc agaagtttat gtgttgtcaa aagaggaagg aggacgtcat       960
     actccattct tcaaaggtta ccgtccacaa ttctatttcc gtactactga cgtaaccggt      1020
     acaattgaat taccggaagg tgttgaaatg gtcatgcctg gcgataacat caaaatgaca      1080
     gtaagcttaa ttcacccgat tgcgatggac caagggttac gttttgcgat tcgtgaaggt      1140
     ggacgtactg taggtgcggg tgttgttgct aagatcatta agtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page