(data stored in ACNUC7421 zone)

EMBL: CP000947.PE64

CP000947.PE64        Location/Qualifiers
FT   CDS_pept        57327..58280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0064"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: hso:HS_0196
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32296"
FT                   /db_xref="GOA:B0UV22"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV22"
FT                   /protein_id="ACA32296.1"
FT                   /translation="MEELNTIKLSDHLTPFLTFNRQQWAELRKSVPLKLTEQDLKPLLG
FT                   FNEELSLEEVSTIYLPLARLINYYIEENLRRQTVLKRFLSGHNPKVPYIISIAGSVSVG
FT                   KSTSARILQSLLANWPVARKVDLITTDGFLYPLEILQKKNLLQKKGFPISYDTQRLIRF
FT                   LADIKSGKKNVKAPIYSHLTYDIIPNQFDIVDRPDILILEGLNVLQIGSNKSNQMFVSD
FT                   FVDFSIFVDAEEDQLKEWYIKRFLKFCRSAFTDPNSYFKHYANLSEQEAIETASQIWDN
FT                   INGLNLKQNILPTRERANLILKKGENHKVELVKLRK"
     gtggaagaac tcaacactat taaactttct gaccacttaa cgcctttttt aacttttaat        60
     cggcaacagt gggctgaatt gcgaaaatca gtacctttga aactaacaga gcaggatttg       120
     aagccactat tgggttttaa tgaggagctt tctttagagg aggtgagtac aatttactta       180
     cctcttgctc gtctgattaa ttactatata gaggaaaatt tacgacggca gactgtcctc       240
     aaacgttttc tcagcgggca taatcctaaa gtaccttata tcattagtat tgcaggtagt       300
     gtgtcggtgg gtaaaagtac atcagcccga attctacaat cgctattggc caattggccc       360
     gttgcaagaa aggtagactt aattaccact gatggatttt tatatccact ggaaatatta       420
     cagaagaaaa atttgttgca aaaaaaaggg ttccctattt cgtatgatac tcagcgatta       480
     attcgttttt tagctgatat taaatcgggt aaaaaaaatg ttaaagcacc aatttattct       540
     catttaacct acgacattat acccaaccaa tttgatattg ttgatcgtcc ggatatttta       600
     attttagaag gtcttaatgt tttgcaaatt gggtctaata aatcaaatca aatgttcgta       660
     tctgattttg ttgatttttc aatttttgtt gatgcagagg aggatcaatt aaaagaatgg       720
     tatataaaac gctttctaaa attttgtcgc agtgctttta cagatccgaa ttcttacttt       780
     aaacattatg ccaacttatc tgaacaggaa gccatcgaaa ccgcaagtca aatttgggat       840
     aatattaatg gcttaaattt gaaacaaaat attttaccga caagagaacg agcgaattta       900
     atcctaaaaa aaggagaaaa ccacaaagtt gaattggtca aacttaggaa ataa             954
//

If you have problems or comments...

PBIL Back to PBIL home page