(data stored in ACNUC7421 zone)

EMBL: CP000947.PE66

CP000947.PE66        Location/Qualifiers
FT   CDS_pept        complement(59724..63200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0066"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hso:HS_0198 DNA-directed DNA polymerase, alpha
FT                   subunit (DNA polymerase III, alpha subunit); TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32318"
FT                   /db_xref="GOA:B0UV24"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV24"
FT                   /protein_id="ACA32318.1"
FT                   /translation="MSQPRFVHLRVHSDFSMINGITKVKPLIKACVQHEMVAMALTDFT
FT                   NFCGLVRFYGEAQSSGVKPIIGADVLVKSDLLGDELFELTLLAKNNEGYHNITLLLSKA
FT                   YERGYYNLPYIDQSWLAEHHEGIIILSGGRNGDVGKKLLKNNSADVETAVAFYQEYFPD
FT                   HFYLSLSRTGRSDEDRYIQSALILAQQKQLPLVATNDVCFLSPEDFEAHEIRVAIHDGY
FT                   TLDDPKRPKLYSSQQYFRSEQEMCELFADIPTALENTVLIAQRCNVTIRLGTYFLPKFP
FT                   TGDLSPEDFLIQKSKEGLEERLQTLFPDPQVRSEKRKEYDDRLQTELDVINKMGFPGYF
FT                   LIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMP
FT                   DFDVDFCMDKRDRVIEHVAETYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRI
FT                   AKLIPADPGMTLTKAFEAEPRLSEIYNNDEEVKALIDMARKLEGVTRNAGKHAGGVVIS
FT                   PSLITDFSPLYCDSEGKHPVTHFDKNDVEYAGLVKFDFLGLRTLTIIKWALDMINARLV
FT                   KEGKSAVDISTIPLNDPDSFNLLKKAETTAVFQLESRGMKDLIKKLQPDCFEDIIALVA
FT                   LFRPGPLESGMVQNFIDRKHGVEPVSYPDVKYQHESLKPILEPTYGVIVYQEQVMQIAQ
FT                   VLAGYSLGGADLLRRAMGKKKPEEMAAQRDIFEKGAIAKGIDGDLAMKIFDLVEKFAGY
FT                   GFNKSHSAAYALVSYQTLWLKTHYPAEFMAAVMTSEMDNTDKIVSFYDECLRMGLTIVP
FT                   PDINTGKHHFSVNDNGEIVYGIGAIKGVGEVPINAIVSAREQGGIFKDLFDLCARVDLK
FT                   QINRRTFENLIKSGAFDKLGPHRAALAQNLEDALKASDQHAKDEAIGQVDMFGVLTSSH
FT                   EDVETAYAHTPRWSEKQILDGERETLGLYLSSHPITRYLKELSHYSSTRLNELSPNTRG
FT                   KISTVCGLIVALRFAVTKKGNRLGIATLDDRSGLLDITLFADALERFGDKLQKDTVVIV
FT                   SGTVSFDDFSQGLKMSVRELMTLDEARSRYAKNLAISLSQEQITPHFIRQLKGIIEPCS
FT                   GGSLPIHLYYQSKDGRALIRFGVQWSVYPTDELLSALVTMLGENAVELEFD"
     atgtcacagc ctcgttttgt acatttgcgt gtacacagtg atttttccat gattaacggc        60
     attactaagg taaaaccttt gataaaagcc tgtgtgcaac atgaaatggt ggcaatggca       120
     ttgactgatt ttactaactt ttgtggctta gttcgttttt atggtgaagc acaatcttca       180
     ggcgttaagc ctattatcgg tgctgatgtt ctcgtgaaaa gtgatttgtt gggagatgaa       240
     ctttttgaac tgacgttatt agccaaaaat aacgagggtt atcataatat taccttatta       300
     ctttcgaagg cttatgaacg tggttattat aatttacctt acattgatca gtcttggttg       360
     gcagaacatc atgagggaat tatcatttta tccggtggtc gcaatggcga tgtagggaaa       420
     aaattactga aaaataattc tgctgatgtg gaaactgcgg tagcttttta tcaagaatat       480
     tttcccgacc acttttattt aagtttaagt cgcaccggtc gatccgatga agatcgctat       540
     attcaatctg ctttaatact tgcacagcaa aaacaattac ctttagtagc aacaaatgat       600
     gtgtgttttt taagtccgga ggattttgag gcacatgaaa ttcgagttgc cattcatgat       660
     ggttatacac tggatgatcc gaaacgcccg aaattataca gttcacaaca atatttccgc       720
     tcggagcaag aaatgtgtga gctgtttgct gatattccta ccgcacttga aaatactgta       780
     ttaatagcac aacgttgtaa tgtcactatt cgcttaggga cttatttttt accgaaattt       840
     ccaacgggtg acttaagtcc ggaagatttt ttaatccaaa aatcgaaaga gggattagag       900
     gagcgtttgc agaccctgtt tcctgatccg caagtgcggt cagaaaaacg taaagaatac       960
     gatgatcgct tacaaaccga actggatgtc attaataaaa tgggctttcc cggttatttt      1020
     ttgatcgtga tggagtttat tcagtggtca aaagataatg atattcctgt aggaccagga      1080
     cgtggttccg gagcaggttc tttagtcgcc tatgcgttaa aaattaccga tttggatcct      1140
     cttgaatttg atttgctttt tgagcgtttt ctcaatcctg aacgtgtttc tatgccggat      1200
     tttgatgtgg atttctgtat ggacaagcga gatcgtgtga ttgagcatgt tgcagaaact      1260
     tatgggcgtg gagcggtttc gcaaatcatc acatttggaa caatggcggc aaaagcggtt      1320
     attcgtgatg tggggcgtgt attgggacac ccttatggtt ttgtggatcg tattgctaaa      1380
     ttaattcccg ccgatccggg tatgaccttg acaaaggctt ttgaggcaga accgagatta      1440
     tccgaaattt ataacaatga tgaagaagtg aaagccttaa ttgatatggc aagaaaattg      1500
     gagggagtaa cacgtaatgc gggtaaacat gcgggcggtg tagttatttc tcctagttta      1560
     attacagatt tctcacctct atattgcgac tcggaaggga aacatcctgt tacacatttt      1620
     gataaaaatg atgttgaata tgcaggatta gtgaaatttg actttttagg cttacgcacg      1680
     ctgaccatta ttaaatgggc attggatatg attaacgctc gtttggttaa agagggtaaa      1740
     agtgcggtag atatttcgac aattccttta aatgatcccg attcatttaa cttgttaaaa      1800
     aaagctgaaa ccacagcagt cttccagctg gagtcgaggg gaatgaaaga tcttatcaag      1860
     aaacttcagc ccgactgttt tgaggatatt attgcacttg tagcattatt ccgccccggt      1920
     cctttagagt ctggaatggt gcaaaacttt atcgatcgta aacacggagt ggaacctgtt      1980
     tcttatcctg atgttaagta tcaacatgaa tcccttaagc cgattttaga acctacctat      2040
     ggggttatcg tttatcaaga acaagtcatg caaattgcac aagtactggc gggatacagc      2100
     cttggcggtg cggatttatt gcgtagagcg atgggtaaga aaaaacctga agaaatggca      2160
     gcacaacgag atatttttga aaaaggtgcg atagcaaaag ggattgatgg cgatttagcc      2220
     atgaaaatct ttgacttagt ggaaaaattc gccggttatg gctttaataa atctcattct      2280
     gccgcttatg ctttggtttc ttatcaaacc ctttggttaa aaacacatta tcccgctgaa      2340
     tttatggcag cggtgatgac ctcagagatg gataacacag acaagatcgt gagcttttat      2400
     gatgagtgtt tacgtatggg tctcactatt gttccccctg atattaatac aggcaaacat      2460
     cattttagtg tgaatgataa tggtgaaatt gtttatggta ttggtgcaat aaaaggcgtt      2520
     ggagaagtcc caataaatgc aatagtttca gcccgtgaac aaggcggaat ttttaaagat      2580
     ttattcgatc tttgtgcgag agtagattta aaacagatta atcgtcgcac ctttgaaaat      2640
     ctaattaaat ccggtgcgtt tgataaattg ggtccacatc gagccgcact tgcccaaaat      2700
     ttggaagatg cgttgaaagc atcggatcag catgcaaaag atgaggcgat aggacaggtt      2760
     gatatgtttg gtgtactaac ttcaagccat gaagatgttg aaaccgctta tgcacacacg      2820
     ccacgttgga gcgagaaaca aattttagac ggtgagcgtg aaacattagg tttgtattta      2880
     agcagtcatc cgattactcg ttatttaaaa gagttgtctc attacagttc gacacgttta      2940
     aatgagttat ctccaaacac tcgaggcaaa ataagtactg tttgcggttt aattgtagca      3000
     ttaagatttg cagtgacgaa aaaaggaaac cgattaggta ttgcaacttt agatgaccgt      3060
     tccgggcttt tagatataac gttgtttgct gatgctttag aacgttttgg tgataaatta      3120
     cagaaggaca ccgttgttat tgtttccggt acagtcagtt ttgatgattt ttctcaaggg      3180
     ctaaaaatgt ctgtacgaga gttaatgact ttagatgaag ctcgtagtcg ttatgcaaaa      3240
     aatttagcca tcagcttatc ccaagagcaa ataacaccgc actttattcg ccaactcaaa      3300
     ggaattattg aaccttgtag cggcggttct ttgccaatac atctttacta tcaaagtaaa      3360
     gacggacgag ctttgatacg cttcggtgtg caatggtctg tttatccaac agatgagtta      3420
     ttgagtgcac tggtaacaat gttaggagaa aatgcggttg agcttgaatt tgactaa         3477
//

If you have problems or comments...

PBIL Back to PBIL home page